UniGene Name: sp_v3.0_unigene42116
Length: 132 nt
![]() |
---|
>sp_v3.0_unigene42116
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | purple acid phosphatase 2 [Solanum tuberosum] | - | - | 4.0e-19 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | Purple acid phosphatase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acid phosphatase. | EC:3.1.3.2 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminobenzoate degradation | 00627 | 0.0 | % | |
Sma3 | Riboflavin metabolism | 00740 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AP1; AT11; AT2G16430; AT7; AT9; ATH2; At10; At1g52940; At1g56360; At2g16430; At2g27190; At4g36350; Ath1; C7A10.1010; F13N6.16; F14G24.21; F14G9.2; F16F14.7; F23E13.190; GSVIVT00014522001; GSVIVT00014523001; GSVIVT00032768001; GSVIVT00035928001; GSVIVT0003 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | extracellular space | GO:0005615 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | acid phosphatase activity | GO:0003993 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fibronectin, type III | IPR003961 | - | 0.0 | - |
Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
Sma3 | Fatty acid hydroxylase | IPR006694 | - | 0.0 | - |
Sma3 | Purple acid phosphatase, N-terminal | IPR015914 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G16430.2 | - | 5.0e-24 | 81% |
RefSeq | Arabidopsis thaliana | NP_849960.1 | purple acid phosphatase 10 [Arabidopsis thaliana] | 2.0e-24 | 81% |
RefSeq | Populus trichocarpa | XP_002307690.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 88% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVR5
Fln msg: Distance to subject end: 231 aas, your sequence is shorter than subject: 44 - 517
Fln protein:
D
Protein Length:
45
Fln nts:
G
Fln Alignment:
CL21414Contig1___DTWGRFTEKSTAYQPWIWTAGNHEIDFVPEIGEKRPFKPYTHRY
A9NVR5_______________DTWGRFIEPSAAYQPWIWTAGNHEIEFRPKLGKTIPFEPYLHRY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain