UniGene Name: sp_v3.0_unigene41992
Length: 156 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene41992
G |
Ace file of the UniGene sp_v3.0_unigene41992 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | helicase associated domain-containing protein [Arabidopsis thaliana] gb|AEE33493.1| helicase associated domain-containing protein [Arabidopsis thaliana] | - | - | 7.0e-19 | 88% |
FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 56% |
Sma3 | ATP-dependent RNA helicase, putative | - | - | 6.053e-16 | - |
Source | Gene names |
---|---|
Sma3 | At1g58050; At2g01130; At2g30800; At2g35920; B0308C03.3; B1143G03.7-1; CHLREDRAFT_122089; Dhx57; F11I4_16; GSVIVT00003541001; GSVIVT00009138001; GSVIVT00017756001; GSVIVT00018850001; GSVIVT00030427001; GSVIVT00035410001; LOC_Os03g53760; MICPUCDRAFT_197; MI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | chalcone isomerase activity | GO:0045430 | Molecular Function | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G58060.1 | RNA helicase family protein chr1:21489480-21501775 REVERSE LENGTH=1459 | 2.0e-24 | 88% |
RefSeq | Arabidopsis thaliana | NP_176103.2 | helicase associated domain-containing protein [Arabidopsis thaliana] | 3.0e-24 | 88% |
RefSeq | Populus trichocarpa | XP_002328701.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-24 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O22899
Fln msg: Distance to subject end: 588 aas, your sequence is shorter than subject: 51 - 729
Fln protein:
E
Protein Length:
52
Fln nts:
G
Fln Alignment:
CL19929Contig1___ETGCGKTTQVPQYILDDMIL--SGQGGFCNIICTQPRRIAAISVAERVADE
O22899_______________ETGSGKTTQIPQFVLDAVVADNSDKGRKWLVGCTQPRRVAAMSVSRRVADE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain