UniGene Name: sp_v3.0_unigene41612
Length: 156 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene41612
A |
Ace file of the UniGene sp_v3.0_unigene41612
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pattern formation protein, putative n=1 Tax=Ricinus communis RepID=B9SVJ6_RICCO | - | - | 6.0e-19 | 86% |
| FL-Next | sp=Pattern formation protein EMB30; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 78% |
| Sma3 | Pattern formation protein, putative | - | - | 5.294e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g13980; At5g19610; At5g39500; EMB30; F16A14.20; F7A19.7; GEP1; GNOM; GSVIVT00015712001; GSVIVT00016764001; H0207B04.10; LOC_Os03g46330; MICPUCDRAFT_31003; MICPUN_59868; OSJNBa0056E06.17; OSJNBb0042G06.4; OSJNBb0050O03.11; OSTLU_88403; Os02g0326600; Os0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ARF guanyl-nucleotide exchange factor activity | GO:0005086 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | GTP:GDP antiporter activity | GO:0010292 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis by cell plate formation | GO:0000911 | Biological Process | 0.0 | - |
| Sma3 | establishment of planar polarity | GO:0001736 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | cell adhesion | GO:0007155 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
| Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
| Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
| Sma3 | regulation of ARF protein signal transduction | GO:0032012 | Biological Process | 0.0 | - |
| Sma3 | regulation of vesicle targeting, to, from or within Golgi | GO:0048209 | Biological Process | 0.0 | - |
| Sma3 | root hair cell differentiation | GO:0048765 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | SEC7-like | IPR000904 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G39500.1 | GNL1, ERMO1 GNOM-like 1 chr5:15815274-15819910 FORWARD LENGTH=1443 | 6.0e-24 | 86% |
| RefSeq | Arabidopsis thaliana | NP_198766.1 | protein GNOM-like 1 [Arabidopsis thaliana] | 8.0e-24 | 86% |
| RefSeq | Populus trichocarpa | XP_002324976.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42510
Fln msg: Distance to subject end: 728 aas, your sequence is shorter than subject: 52 - 1451
Fln protein:
R
Protein Length:
53
Fln nts:
A
Fln Alignment:
CL15259Contig1___RYYEQSPQILADKDAAFVLAYSLILLNTDQHNAQVKRKMTEDDFIRNNRRIN
Q42510_______________RYYMQSPEILANKDAALVLSYSIIMLNTDQHNVQVKKKMTEEDFIRNNRHIN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta