UniGene Name: sp_v3.0_unigene41472
Length: 157 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene41472
G |
Ace file of the UniGene sp_v3.0_unigene41472 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | myosin heavy chain class XI E3 protein, putative [Oryza sativa Japonica Group] | - | - | 2.0e-19 | 84% |
| FL-Next | tr=Uncharacterized protein; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 86% |
| Sma3 | Myosin XI, putative | - | - | 2.749e-23 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g28710; AT4g33200; At1g17580; At2g20290; At2g31900; At2g33240; At3g58160; At4g33200; At5g20490; At5g43900; CHLREDRAFT_185104; F16A16.180; F20D22.7; F4I10.130; F9D24.70; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00007494001; GSVIVT00009578001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
| Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G20490.1 | XIK, ATXIK, XI-17 Myosin family protein with Dil domain chr5:6927064-6936825 REVERSE LENGTH=1545 | 1.0e-23 | 80% |
| RefSeq | Arabidopsis thaliana | NP_001154724.1 | Myosin family protein with Dil domain [Arabidopsis thaliana] | 2.0e-23 | 80% |
| RefSeq | Populus trichocarpa | XP_002309201.1 | predicted protein [Populus trichocarpa] | 5.0e-25 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: I1MSD7
Fln msg: Distance to subject end: 1404 aas, your sequence is shorter than subject: 52 - 1531
Fln protein:
E
Protein Length:
53
Fln nts:
G
Fln Alignment:
CL13868Contig1___EPGVLHNLSTRYELDEIYTYTGSILIAINPFKRLPHLYDSQMMEQYKGATFG
I1MSD7_______________EPGVLHNLATRYELNEIYTYTGNILIAINPFQRLPHLYDTHMMEQYKGAAFG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)