UniGene Name: sp_v3.0_unigene41380
Length: 125 nt
UniGene Fasta |
---|
>sp_v3.0_unigene41380
A |
Ace file of the UniGene sp_v3.0_unigene41380 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cellulose synthase-like D3-1, glycosyltransferase family 2 protein n=2 Tax=Selaginella moellendorffii RepID=D8R581_SELML | - | - | 1.0e-16 | 92% |
FL-Next | tr=Cellulose synthase; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 73% |
Sma3 | Cellulose synthase | - | - | 3.79752e-43 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 3.299e-20 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ATHB; At1g02730; At1g32180; At2g21770; At2g33100; At3g03050; At4g38190; At5g05170; At5g09870; At5g16910; At5g17420; At5g64740; CESA09; CESA1; CESA2; CESA3; CESA4; CESA5; CESA6; CESA7; CESA8; CESA9; CEV1; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CSLD6; CSLF4; Ce |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | cellulose synthase complex | GO:0010330 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | 1,4-beta-D-xylan synthase activity | GO:0047517 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | primary cell wall biogenesis | GO:0009833 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
Sma3 | rhamnogalacturonan I side chain metabolic process | GO:0010400 | Biological Process | 0.0 | - |
Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
Sma3 | cortical microtubule organization | GO:0043622 | Biological Process | 0.0 | - |
Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | Gonadotropin, beta subunit, conserved site | IPR018245 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03050.1 | CSLD3, KJK, ATCSLD3 cellulose synthase-like D3 chr3:687873-691629 FORWARD LENGTH=1145 | 2.0e-21 | 90% |
RefSeq | Arabidopsis thaliana | NP_186955.1 | cellulose synthase-like protein D3 [Arabidopsis thaliana] | 3.0e-21 | 90% |
RefSeq | Populus trichocarpa | XP_002320989.1 | predicted protein [Populus trichocarpa] | 6.0e-22 | 92% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q4VWW7
Fln msg: Distance to subject end: 466 aas, your sequence is shorter than subject: 41 - 1096
Fln protein:
S
Protein Length:
42
Fln nts:
A
Fln Alignment:
CL12737Contig1___SLALREAMCFMMDRG-GDRICYVQFPQRFEGVDPSDRYANHN
Q4VWW7_______________SRALREAMCFMMDPTLGKKVCYVQFPQRFDGIDRNDRYANHN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain