UniGene Name: sp_v3.0_unigene41307
Length: 227 nt
![]() |
---|
>sp_v3.0_unigene41307
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | high-affinity K+ transporter [Capsicum annuum] | - | - | 2.0e-22 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | Putative potassium transporter | - | - | 2.337e-32 | - |
Source | Gene names |
---|---|
Sma3 | 6J23.11; At1g31120; At1g60160; At1g70300; At2g30070; At2g35060; At2g40540; At3g02050; At4g13420; At4g19960; At4g23640; At4g33530; At5g09400; At5g14880; B1026C12.31-1; CHLREDRAFT_121784; CHLREDRAFT_121823; CHLREDRAFT_121889; CHLREDRAFT_123407; F17M5.1; F17 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | potassium:sodium symporter activity | GO:0009674 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transmembrane transporter activity | GO:0015079 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | K+ potassium transporter | IPR003855 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | IPR018519 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G13420.1 | HAK5, ATHAK5 high affinity K+ transporter 5 chr4:7797038-7802174 REVERSE LENGTH=785 | 8.0e-27 | 80% |
RefSeq | Arabidopsis thaliana | NP_567404.1 | Potassium transporter 5 [Arabidopsis thaliana] | 1.0e-26 | 80% |
RefSeq | Populus trichocarpa | XP_002297888.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P149
Fln msg: Distance to subject end: 89 aas, your sequence is shorter than subject: 75 - 225
Fln protein:
Q
Protein Length:
76
Fln nts:
T
Fln Alignment:
CL11915Contig1___SIGVVYGDIGTSPLYVFSSTFTDGIRHPDDILGAXXXXXXXXXXXXXXKYVFIVLWANDNGDGGTFALYSLICR
A9P149_______________SFGVVYGDLGTSPLYVFSSTFPDGIQDSEDVMGALSLIIYTLTLIPLLKYVFVVMRANDNGEGGTFALYSLLCR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain