|
||||||
|
UniGene Name: sp_v3.0_unigene41190
Length: 161 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene41190
A |
|
Ace file of the UniGene sp_v3.0_unigene41190
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative transketolase [Oryza sativa Japonica Group] | - | - | 2.0e-13 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | TK | - | - | 1.111e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transketolase. | EC:2.2.1.1 | - | 2.158e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose phosphate pathway | 00030 | 2.158e-10 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 2.158e-10 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.158e-10 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 2.158e-10 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 2.158e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.158e-10 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.158e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | 134P10.11; GSVIVT00018168001; GSVIVT00026404001; Os06g0133800; OsI_21507; OsJ_20020; P0001H02.3; P0679C08.41; PHYPADRAFT_221481; POPTRDRAFT_552034; POPTRDRAFT_805600; RCOM_0262670; TKT10; TKT7; VITISV_017140; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | transketolase activity | GO:0004802 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transketolase, N-terminal | IPR005474 | - | 0.0 | - |
| Sma3 | Transketolase-like, pyrimidine-binding domain | IPR005475 | - | 0.0 | - |
| Sma3 | Transketolase, C-terminal | IPR005476 | - | 0.0 | - |
| Sma3 | Transketolase, bacterial-like | IPR005478 | - | 0.0 | - |
| Sma3 | Transketolase-like, C-terminal | IPR015941 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G45290.1 | Transketolase chr2:18672737-18675589 FORWARD LENGTH=741 | 2.0e-16 | 58% |
| RefSeq | Arabidopsis thaliana | NP_566041.2 | Transketolase [Arabidopsis thaliana] | 3.0e-16 | 58% |
| RefSeq | Populus trichocarpa | XP_002315311.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNE5
Fln msg: Distance to subject end: 41 aas, your sequence is shorter than subject: 53 - 224
Fln protein:
L
Protein Length:
54
Fln nts:
A
Fln Alignment:
CL9887Contig1___LRKEGRKVRVVSLVCWELFDEQPQAYRDAILPPSVEKRLSVEAGSPLGWREYV
A9NNE5_______________LRNEGKAVRVVSFVCWELFEEQTPEYKESVLPAAVAARVSVEAGSTFGWERYL
| SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 12 | 24 | GAAG GAAG GAAG G | 13 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
