UniGene Name: sp_v3.0_unigene41130
Length: 236 nt
![]() |
---|
>sp_v3.0_unigene41130
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] | - | - | 4.0e-34 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Cell division cycle protein 48 homolog | - | - | 7.622e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 2.298e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT3G09840; At1g03000; At3g09840; At3g53230; At3g56690; At4g04910; At5g03340; CAFP; CDC48; CDC48A; CDC48D; CDC48E; CHLREDRAFT_103983; CHLREDRAFT_113394; CHLREDRAFT_120247; CHLREDRAFT_134171; CHLREDRAFT_38371; F10O3.18; F12E4_70; GSVIVT00016023001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
Sma3 | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
Sma3 | peroxisome organization | GO:0007031 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
Sma3 | protein import into peroxisome matrix | GO:0016558 | Biological Process | 0.0 | - |
Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G08470.1 | PEX1 peroxisome 1 chr5:2735925-2742731 FORWARD LENGTH=1130 | 9.99967e-42 | 92% |
RefSeq | Arabidopsis thaliana | NP_196464.2 | peroxisome 1 [Arabidopsis thaliana] | 1.99993e-41 | 92% |
RefSeq | Populus trichocarpa | XP_002298113.1 | predicted protein, partial [Populus trichocarpa] | 0.0 | 94% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACE6
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 78 - 442
Fln protein:
F
Protein Length:
79
Fln nts:
T
Fln Alignment:
CL9235Contig1___FFDEFDSIAPKRGHDNTGVT--DRVVNQLLTELDGVEALTGVFVFAATSRPDLLDAALLRPGRLDRLLFCDFPSARERLE
D5ACE6_______________FFDEIDGLAVAREHSSGAISVGDRVMSQLLVEMDGLNPRIGVTVIAATNRPDKIDAALMRPGRFDRLVYVGLPNQADRKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain