SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene41074

Length: 248 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene41074
GAGCAACCTCTAGGCTATGAGAAGAAAGGCCAAGAGCACAAAGTCTGTAGATTGAAGAAAGCTCTTTATGGGCTGAAGCAAGCACCAAGAGCATGGTACAGTAGGATAGATTCCTATCTACTGGAAAATGGATTTGAGAAGTGTGAGGGAGAACCCACTGTTTATATCAAAGAAAAGGACGGTAAAATTTTAATTGTTGTGTTATATGTTGATGATGTGATTTTTACAAGTAATGATGACTACCTCAT

Ace file of the UniGene sp_v3.0_unigene41074 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RVT_2 domain containing protein	-	-	7.0e-37	50%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	64%
Sma3	Reverse transcriptase	-	-	4.615e-19	-

Source	Gene names
Sma3	At2g15650; At2g17490; F11I4_21; LOC_Os03g26290; LOC_Os03g61660; LOC_Os10g01750; LOC_Os12g05520; LOC_Os12g44200; OSJNBa0013O08.17; OSJNBa0053E05.7; OSJNBa0065H03.10; OSJNBa0078D06.27; Os10g0106900; RT; T15M6.14; T16L24.270; T18I24.5; T20K12.230; T28P6.8; T

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	potassium ion transmembrane transporter activity	GO:0015079	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	potassium ion transport	GO:0006813	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	K+ potassium transporter	IPR003855	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3		IPR010256	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Distance to subject end: 171 aas, your sequence is shorter than subject: 82 - 363

Fln protein: EQPLGYEKKGQEHKVCRLKKALYGLKQAPRAWYSRIDSYLLENGFEKCEGEPTVYIKEKDGKILIVVLYVDDVIFTSNDDYL

Protein Length: 83

Fln nts: GAGCAACCTCTAGGCTATGAGAAGAAAGGCCAAGAGCACAAAGTCTGTAGATTGAAGAAAGCTCTTTATGGGCTGAAGCAAGCACCAAGAGCATGGTACAGTAGGATAGATTCCTATCTACTGGAAAATGGATTTGAGAAGTGTGAGGGAGAACCCACTGTTTATATCAAAGAAAAGGACGGTAAAATTTTAATTGTTGTGTTATATGTTGATGATGTGATTTTTACAAGTAATGATGACTACCTCAT

Fln Alignment:

CL8610Contig1___EQPLGYEKKGQEHKVCRLKKALYGLKQAPRAWYSRIDSYLLENGFEKCEGEPTVYIK
B8LKV8_______________QQPPRYEVRGQEDKVYRLKKALNGLKQAPRAWYSKIDSYMIKNEFIRSTSEPTLYTK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain