UniGene Name: sp_v3.0_unigene40812
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene40812
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phosphatidylinositol phoshate kinase n=2 Tax=Physcomitrella patens RepID=B5TVL9_9BRYO | - | - | 2.0e-26 | 65% |
FL-Next | sp=Phosphatidylinositol 4-phosphate 5-kinase 9; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 38% |
Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, putative | - | - | 8.474e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase. | EC:2.7.1.68 | - | 5.425e-26 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol phosphate metabolism | 00562 | 5.425e-26 | % | |
Sma3 | Metabolic pathways | 01100 | 5.425e-26 | % | |
Sma3 | Phosphatidylinositol signaling system | 04070 | 5.425e-26 | % |
Source | Gene names |
---|---|
Sma3 | At1g21980; At1g77740; At3g07960; At3g09920; F17A17.30; F2E2.1; F8A24.2; GSVIVT00000598001; GSVIVT00000653001; GSVIVT00015324001; GSVIVT00030918001; OJ1119_A01.22-1; OJ1477_F01.115; Os02g0822500; Os07g0658700; OsI_09497; OsI_27184; OsJ_08924; P5K1; PHYPADR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | actin monomer binding | GO:0003785 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | phosphatidylinositol phosphate kinase activity | GO:0016307 | Molecular Function | 0.0 | - |
Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase activity | GO:0016308 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular amino acid metabolic process | GO:0006520 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | phosphatidylinositol metabolic process | GO:0046488 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core | IPR002498 | - | 0.0 | - |
Sma3 | MORN motif | IPR003409 | - | 0.0 | - |
Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup | IPR016034 | - | 0.0 | - |
Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, plant | IPR017163 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G09920.1 | PIP5K9 phosphatidyl inositol monophosphate 5 kinase chr3:3040426-3043676 REVERSE LENGTH=815 | 3.0e-29 | 61% |
RefSeq | Arabidopsis thaliana | NP_001189852.1 | phosphatidylinositol-4-phosphate 5-kinase 9 [Arabidopsis thaliana] | 4.0e-29 | 61% |
RefSeq | Populus trichocarpa | XP_002307416.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 59% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8L850
Fln msg: Distance to subject end: 581 aas, your sequence is shorter than subject: 71 - 815
Fln protein:
E
Protein Length:
72
Fln nts:
G
Fln Alignment:
CL4987Contig1___EGRYIWENGNEYVGEWKGGLMCGKGTLTWANGNKYEGQWLDGFEHGEGIY
Q8L850_______________KGTLTWVTGDSYEGSWLNGMMHGVGVYTWSDGGCYVGTWTRGLKDGKGSF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain