UniGene Name: sp_v3.0_unigene40344
Length: 136 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene40344
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Pinus nigra RepID=B3U1V3_9CONI | - | - | 2.0e-16 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g04840; At1g09410; At1g20230; At1g47580; At1g56690; At2g22070; At3g03580; At3g23330; At3g24000; At3g26782; At3g62890; At4g14050; At4g16835; At4g30700; At4g33170; At4g33990; At5g06540; At5g09950; B1080A02.28; DYW10; DYW9; EMB2758; F13M7.17; F14J9.7; F14 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | IPR018115 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33990.1 | EMB2758 Tetratricopeptide repeat (TPR)-like superfamily protein chr4:16290141-16292612 REVERSE LENGTH=823 | 4.0e-18 | 80% |
RefSeq | Arabidopsis thaliana | NP_567948.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-18 | 80% |
RefSeq | Populus trichocarpa | XP_002300144.1 | predicted protein [Populus trichocarpa] | 1.0e-18 | 79% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 44 - 246
Fln protein:
P
Protein Length:
45
Fln nts:
C
Fln Alignment:
CL21906Contig1___PGTTIRVIKNLRVCGDCHSAIKFISKIAAREIIVRDANRYHHFK
D5AAE0_______________PGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain