|
||||||
|
UniGene Name: sp_v3.0_unigene39735
Length: 207 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene39735
A |
|
Ace file of the UniGene sp_v3.0_unigene39735 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | serine/threonine protein kinase pk23 [Solanum lycopersicum] | - | - | 8.0e-25 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | CDPK-related protein kinase | - | - | 3.383e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 2.017e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G66210; At1g49580; At2g17890; At2g41140; At2g46700; At3g19100; At3g49370; At3g50530; At3g56760; At5g24430; At5g66210; CAMK1; CDPK1; CDPK5; CPK16; CPK18; CPK28; CPK5; CPK6; CRK; CRK1; CRK2; CRK3; CRK4; CRK5; CRK7; CRK8; F14J22.18; F2K15.230; GSVIVT00009 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin-dependent protein kinase activity | GO:0004683 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | Calmodulin-binding domain, plant | IPR012417 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G50530.2 | CRK CDPK-related kinase chr3:18753833-18756487 FORWARD LENGTH=632 | 2.0e-28 | 71% |
| RefSeq | Arabidopsis thaliana | NP_190622.1 | CDPK-related kinase [Arabidopsis thaliana] | 2.0e-28 | 71% |
| RefSeq | Populus trichocarpa | XP_002320890.1 | predicted protein [Populus trichocarpa] | 2.0e-30 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWM8
Fln msg: Distance to subject end: 328 aas, your sequence is shorter than subject: 69 - 589
Fln protein:
I
Protein Length:
70
Fln nts:
A
Fln Alignment:
CL14905Contig1___ILKALSGHHNLVIFHDVCEDDNNVYIIMEFCEGGELLDRILSSGGRFSEEDAKDIVVQILSVVAFCHLQ
A9NWM8_______________ILKALSGHHNLVKFHDACEDANNVYIIMELCEGGELLDRILSRGGKYPEEDAKVIVRQILSIVAFCHIQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
