UniGene Name: sp_v3.0_unigene39692
Length: 141 nt
![]() |
---|
>sp_v3.0_unigene39692
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | transcription factor jumonji (jmjC) domain-containing protein [Arabidopsis thaliana] gb|AAK64062.1| putative RB-binding protein [Arabidopsis thaliana] gb|AAS46255.1| putative RB-binding protein [Arabidopsis thaliana] gb|AEE34105.1| transcription factor ju | - | - | 3.0e-21 | 84% |
FL-Next | Isoform 2 of Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 | - | - | 0.0 | 69% |
Sma3 | Jumonji domain protein | - | - | 3.228e-20 | - |
Source | Gene names |
---|---|
Sma3 | AT4g20400; At1g08620; At1g30810/T17H7.10; At1g63490; At2g34880; At4g20400; At5g04240; At5g46910; ELF6; F21E1_160; F9F13.50; GSVIVT00000415001; GSVIVT00002226001; GSVIVT00014013001; GSVIVT00015690001; GSVIVT00035196001; JMJ3502; JMJ905; JMJ906; JMJ907; JMJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | histone H3-K9 demethylation | GO:0033169 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | negative regulation of short-day photoperiodism, flowering | GO:0048577 | Biological Process | 0.0 | - |
Sma3 | negative regulation of long-day photoperiodism, flowering | GO:0048579 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | ATPase, F0 complex, subunit A | IPR000568 | - | 0.0 | - |
Sma3 | ARID/BRIGHT DNA-binding domain | IPR001606 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | JmjC domain | IPR003347 | - | 0.0 | - |
Sma3 | Transcription factor jumonji, JmjN | IPR003349 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal | IPR003888 | - | 0.0 | - |
Sma3 | FY-rich, C-terminal | IPR003889 | - | 0.0 | - |
Sma3 | Zinc finger, C5HC2-type | IPR004198 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-type/integrase, DNA-binding | IPR013087 | - | 0.0 | - |
Sma3 | IPR013129 | - | 0.0 | - | |
Sma3 | Lysine-specific demethylase-like domain | IPR013637 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | FY-rich, C-terminal subgroup | IPR018516 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal subgroup | IPR018518 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G63490.1 | transcription factor jumonji (jmjC) domain-containing protein chr1:23544938-23551946 REVERSE LENGTH=1116 | 3.0e-27 | 84% |
RefSeq | Arabidopsis thaliana | NP_564814.1 | transcription factor jumonji (jmjC) domain-containing protein [Arabidopsis thaliana] | 4.0e-27 | 84% |
RefSeq | Populus trichocarpa | XP_002303585.1 | jumonji domain protein, partial [Populus trichocarpa] | 1.0e-29 | 93% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8GUI6-2
Fln msg: Distance to subject end: 620 aas, your sequence is shorter than subject: 46 - 897
Fln protein:
I
Protein Length:
47
Fln nts:
A
Fln Alignment:
CL14445Contig1___IAGVMVPWLYIGMLFSSFCWHFEDHCFYSINYLHWGEPKCWYSVPG
Q8GUI6-2_____________ISGVIVPWLYVGMCFSTFCWHVEDHHLYSMNYLHTGDPKVWYGIPG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain