UniGene Name: sp_v3.0_unigene39533
Length: 158 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene39533
G |
Ace file of the UniGene sp_v3.0_unigene39533
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | oxoglutarate dehydrogenase - like protein [Arabidopsis thaliana] | - | - | 1.0e-18 | 86% |
| FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 92% |
| Sma3 | 2-oxoglutarate dehydrogenase, E1 subunit | - | - | 3.506e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxoglutarate dehydrogenase (succinyl-transferring). | EC:1.2.4.2 | - | 1.722e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 1.722e-11 | % | |
| Sma3 | Lysine degradation | 00310 | 1.722e-11 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.722e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.722e-11 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.722e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g55410; At5g65750; CHLREDRAFT_79471; F6H11.130; GSVIVT00018534001; MICPUCDRAFT_35900; MICPUN_104793; OGD1; OSIGBa0096P03.7; Os04g0390000; Os07g0695800; OsI_15669; OsJ_14584; Ot03g02230; P0627E10.28; PHYPADRAFT_159607; PHYPADRAFT_175076; POPTRDRAFT_7247 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | oxoglutarate dehydrogenase (succinyl-transferring) activity | GO:0004591 | Molecular Function | 0.0 | - |
| Sma3 | thiamine pyrophosphate binding | GO:0030976 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dehydrogenase, E1 component | IPR001017 | - | 0.0 | - |
| Sma3 | Transketolase-like, pyrimidine-binding domain | IPR005475 | - | 0.0 | - |
| Sma3 | 2-oxoglutarate dehydrogenase, E1 component | IPR011603 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G65750.1 | 2-oxoglutarate dehydrogenase, E1 component chr5:26304212-26307947 FORWARD LENGTH=1025 | 5.0e-24 | 86% |
| RefSeq | Arabidopsis thaliana | NP_201376.1 | 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana] | 7.0e-24 | 86% |
| RefSeq | Populus trichocarpa | XP_002312072.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 92% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9HM58
Fln msg: Distance to subject end: 729 aas, your sequence is shorter than subject: 52 - 1021
Fln protein:
D
Protein Length:
53
Fln nts:
G
Fln Alignment:
CL12800Contig1___DRLIWSAQFENFLATKWTAAKRFGLEGAETLIPSMKEMIDRSADLGVESIVI
B9HM58_______________DRLIWSTQFENFLATKWTAAKRFGLEGGETLIPGMKEMFDRSADLGVESIVI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta