|
||||||
|
UniGene Name: sp_v3.0_unigene39503
Length: 242 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene39503
G |
|
Ace file of the UniGene sp_v3.0_unigene39503
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precur | - | - | 7.0e-24 | 70% |
| FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 28% |
| Sma3 | Extensin-like protein | - | - | 1.527e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g13340; AT4g18670; At1g12040; At3g22800; At3g24480; At4g13340; At4g18670; At5g25550; F12F1.9; F28A21.80; GSVIVT00016771001; GSVIVT00018611001; GSVIVT00020038001; GSVIVT00033788001; LOC_Os03g43650; LOC_Os03g58110; LRX1; NpLRX1; NtLRX1; OJ1174_D05.4; OSJ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | cell morphogenesis involved in differentiation | GO:0000904 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | trichoblast differentiation | GO:0010054 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S3Ae | IPR001593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Repetitive proline-rich cell wall protein repeat | IPR003883 | - | 0.0 | - |
| Sma3 | Extensin repeat | IPR006706 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Ribosomal protein S3Ae, conserved site | IPR018281 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G13340.1 | Leucine-rich repeat (LRR) family protein chr4:7758610-7760892 FORWARD LENGTH=760 | 7.0e-30 | 70% |
| RefSeq | Arabidopsis thaliana | NP_193070.1 | leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] | 9.0e-30 | 70% |
| RefSeq | Populus trichocarpa | XP_002331740.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-31 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 728 aas, your sequence is shorter than subject: 80 - 1145
Fln protein:
N
Protein Length:
81
Fln nts:
G
Fln Alignment:
CL12371Contig1___ATLDEIILMNSNLSGCLPSDITLLKNLTVFDVSFNKLVGPLPDSIGKMVRLEQLDVAHNMLSGNVPQSICGLPNL
Q9FEU2_______________SSLKFVDLSTNSLSGSIPDSFGSLKNLSELEITDNNVSGSIPAALANCTELTQIQLYNNQISGQMPAELGALKKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
