|
||||||
|
UniGene Name: sp_v3.0_unigene38041
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene38041
A |
|
Ace file of the UniGene sp_v3.0_unigene38041
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CBL-interacting serine/threonine-protein kinase, putative n=1 Tax=Ricinus communis RepID=B9S4C5_RICCO | - | - | 7.0e-15 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | CBL-interacting serine/threonine-protein kinase 15 | - | - | 1.166e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 4.306e-23 | - |
| Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 1.931e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | ATPK10; At1g29230; At1g30270; At2g26980; At2g34180; At4g18700; At4g30960; At5g01810; At5g21326; At5g45810; At5g45820; At5g58380; CIPK; CIPK10; CIPK11; CIPK12; CIPK13; CIPK14; CIPK15; CIPK17; CIPK18; CIPK19; CIPK2; CIPK20; CIPK22; CIPK23; CIPK24; CIPK25; C |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | potassium channel activity | GO:0005267 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | response to nutrient | GO:0007584 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
| Sma3 | potassium ion import | GO:0010107 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G18700.1 | CIPK12, SnRK3.9, ATWL4, WL4 CBL-interacting protein kinase 12 chr4:10289110-10290579 REVERSE LENGTH=489 | 2.0e-18 | 66% |
| RefSeq | Arabidopsis thaliana | NP_193605.1 | CBL-interacting serine/threonine-protein kinase 12 [Arabidopsis thaliana] | 2.0e-18 | 66% |
| RefSeq | Populus trichocarpa | XP_002325810.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWN4
Fln msg: Distance to subject end: 373 aas, your sequence is shorter than subject: 60 - 433
Fln protein:
M
Protein Length:
61
Fln nts:
A
Fln Alignment:
Contig38041___MNFASNILMGRYEVGRLLGQGSFAKVYLARNLETGQSVAIKATDIEKILKGGMIEQIKRE
A9NWN4_______________MNIAPNILMGRYEVGRLLGQGSFAKVYLARNLETGQSVAIKAMNIEKILKGGMIEQIKRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
