UniGene Name: sp_v3.0_unigene36945
Length: 218 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene36945
T |
Ace file of the UniGene sp_v3.0_unigene36945
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone n=2 Tax=Populus trichocarpa RepID=B9MWR7_POPTR | - | - | 2.0e-13 | 73% |
| FL-Next | tr=CYP720B5v1; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 40% |
| Sma3 | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone | - | - | 8.529e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g13730; CYP90D; CYP90D2; CYP90D5; CYP90D6; D2; GSVIVT00034159001; GSVIVT00036865001; LOC_Os01g10040; Os01g0197100; OsI_00765; OsI_18805; OsJ_00739; P0419B01.11; P0708D12.2; POPTRDRAFT_678468; POPTRDRAFT_703918; POPTRDRAFT_802964; RCOM_0312700; VITISV_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13730.1 | CYP90D1 cytochrome P450, family 90, subfamily D, polypeptide 1 chr3:4498330-4500836 REVERSE LENGTH=491 | 9.0e-13 | 58% |
| RefSeq | Arabidopsis thaliana | NP_566462.1 | 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana] | 1.0e-12 | 58% |
| RefSeq | Populus trichocarpa | XP_002329023.1 | cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | 1.0e-18 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E5FA71
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 145 aas, your sequence is shorter than subject: 71 - 478
Fln protein:
L
Protein Length:
72
Fln nts:
T
Fln Alignment:
Contig36945___EQYFSMDVICDNMIDLMIPGEDSVPMLMSLAVKFLSDCPLALQQLQEEN
E5FA71_______________EGFLSDEIICDFILFLLLAGHDTSSRAMTFAIKFLTNCPEALNQMKEEH
SNPs (tot: 1) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 141 | 66 | 33 | 0.997452 |

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta