|
||||||
|
UniGene Name: sp_v3.0_unigene36943
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene36943
A |
|
Ace file of the UniGene sp_v3.0_unigene36943
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Laccase n=1 Tax=Pinus taeda RepID=Q9AUI1_PINTA | - | - | 2.0e-28 | 77% |
| FL-Next | tr=Laccase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 96% |
| Sma3 | Laccase | - | - | 6.99248e-43 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 5.823e-31 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 5.823e-31 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.823e-31 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g29130; At2g38080; At3g09220; At5g01190; At5g03260; At5g07130; At5g58910; At5g60020; B1026C12.14; F15A17_290; F16M14.1; F3L24.9; F7J8.170; GLac1; GLac3; GSVIVT00006383001; GSVIVT00008641001; GSVIVT00010239001; GSVIVT00018427001; GSVIVT00018428001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
| Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
| Sma3 | Laccase | IPR017761 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G60020.1 | LAC17, ATLAC17 laccase 17 chr5:24168072-24170223 FORWARD LENGTH=577 | 4.0e-25 | 72% |
| RefSeq | Arabidopsis thaliana | NP_200810.1 | laccase 17 [Arabidopsis thaliana] | 6.0e-25 | 72% |
| RefSeq | Populus trichocarpa | XP_002317504.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-26 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9AUI1
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 80 - 578
Fln protein:
N
Protein Length:
81
Fln nts:
A
Fln Alignment:
Contig36943___NYTGTPPNNTKPMNGTRVKVLPFNTTVQLVLQDTSIAGTESHPFHLHXXXXXXXXXXXXXXXESKDAPSFNLVDPVERNT
Q9AUI1_______________NYTGTPPNNTKPMNGTRVKVIPFNTTVQLVLQDTSIAGTVSHPFHLHGFNFFVVGQGVGNYNESKDAPNFNLVDPVERNT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
