|
||||||
|
UniGene Name: sp_v3.0_unigene34634
Length: 240 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene34634
G |
|
Ace file of the UniGene sp_v3.0_unigene34634
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutathione-S-transferase n=4 Tax=Picea RepID=Q2Q9T2_PICMA | - | - | 8.0e-17 | 55% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | Glutathione s-transferase, putative | - | - | 3.631e-22 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 5.553e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 5.553e-10 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 5.553e-10 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 5.553e-10 | % | |
| Sma3 | Lactoylglutathione lyase. | EC:4.4.1.5 | - | 1.711e-21 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate metabolism | 00620 | 1.711e-21 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g59700; At2g29420; At3g43800; EgHypar; F23H11.1; GST; GST25; GST32; GSTU1; GSTU8; GSVIVT00008584001; GSVIVT00013920001; GSVIVT00021415001; GSVIVT00021417001; GSVIVT00021418001; GSVIVT00022898001; GSVIVT00022906001; GSVIVT00023461001; GSVIVT00024206001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G59700.1 | ATGSTU16, GSTU16 glutathione S-transferase TAU 16 chr1:21936459-21937763 FORWARD LENGTH=234 | 3.0e-21 | 53% |
| RefSeq | Arabidopsis thaliana | NP_176178.1 | glutathione S-transferase TAU 16 [Arabidopsis thaliana] | 4.0e-21 | 53% |
| RefSeq | Populus trichocarpa | XP_002323591.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 52% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NS21
Fln msg: Distance to subject end: 148 aas, atg_distance in limit (1-15): atg_distance = 4, your sequence is shorter than subject: 78 - 230
Fln protein:
M
Protein Length:
79
Fln nts:
G
Fln Alignment:
Contig34634___EEVKLLLIRSSPFAMSCALALREKAVKFEEVHENSLPPKTDRLLRSNPVYKQVPVLIHNGKPVSQSLVILEYIEEAW
A9NS21_______________EQVKVLSLWVSPFSMRVLIGLEEKGVRYEYQEEN-LDPKSELLLQMNPIHKTVPVLIHNGKPVNESLIILEYIDEAW
| SNPs (tot: 1) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 175 | 89 | 10 | 1.0 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
