SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene33417

Length: 363 nt

UniGene Fasta

>sp_v3.0_unigene33417
CTGTGCCACTGGGGAGACCTGTGAAGGCCCCAACGGAACCAGACTCAGTGCTAGCATGAACAACATATCCTTTACAACGCCCAACATTGCCCTGCTTGAGGCTAATGTTTTCGCAATTAATGATGTTTTTACCACGGATTTTCCATCAGATCCTCCCTTTAAATTCAACTACACGGCGGAGGATATACCCAAAAGACTTTGGGTTCCTGGCTCTGGAACAGAAGTGAAAGTGCTTCGTTACAATTCTACAGTGCAACTGGTTTTTCAGACAACAAACATCTTCGTTGCAGAGAACCATCCCATGCATCTTCATGGTTACAATTTTTACGTGGTGGGGGACGGTTTCGGGAACTATGATCCAGT

Ace file of the UniGene sp_v3.0_unigene33417

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Cu-oxidase_2 domain containing protein	-	-	9.0e-15	31%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Sma3	Laccase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Laccase.	EC:1.10.3.2	-	0.0	-
Sma3	L-ascorbate oxidase.	EC:1.10.3.3	-	2.00386e-43	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Ascorbate and aldarate metabolism	00053		2.00386e-43	%
Sma3	Metabolic pathways	01100		2.00386e-43	%

Source	Gene names
Sma3	At2g29130; At2g30210; At2g38080; At2g40370; At5g01040; At5g01050; At5g03260; At5g05390; At5g07130; At5g09360; At5g48100; At5g58910; At5g60020; B1026C12.14; B1088C09.5; F15A17_290; F16M14.1; F7J8.20; F7J8.30; GLac1; GLac3; GLac90; GSVIVT00001780001; GSVIVT

Source	GOs	Term	Type	Identity
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	laccase activity	GO:0008471	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	lignin biosynthetic process	GO:0009809	Biological Process	-
Sma3	secondary cell wall biogenesis	GO:0009834	Biological Process	-
Sma3	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	-
Sma3	lignin catabolic process	GO:0046274	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Oxidoreductase, molybdopterin-binding domain	IPR000572	-	-
Sma3	Multicopper oxidase, type 1	IPR001117	-	-
Sma3	Multicopper oxidase, copper-binding site	IPR002355	-	-
Sma3	Auxin efflux carrier	IPR004776	-	-
Sma3	Bacterial extracellular solute-binding family 1, conserved site	IPR006061	-	-
Sma3	Cupredoxin	IPR008972	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	Multicopper oxidase, type 2	IPR011706	-	-
Sma3	Multicopper oxidase, type 3	IPR011707	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Laccase	IPR017761	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G05390.1	LAC12 laccase 12 chr5:1594753-1597042 FORWARD LENGTH=565	8.00001e-41	57%
RefSeq	Arabidopsis thaliana	NP_196158.1	laccase 12 [Arabidopsis thaliana]	9.99995e-41	57%
RefSeq	Populus trichocarpa	XP_002299682.1	predicted protein [Populus trichocarpa]	3.00018e-42	53%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PRA7

Fln msg: Distance to subject end: 77 aas, your sequence is shorter than subject: 120 - 570

Fln protein: CATGETCEGPNGTRLSASMNNISFTTPNIALLEANVFAINDVFTTDFPSDPPFKFNYTAEDIPKRLWVPGSGTEVKVLRYNSTVQLVFQTTNIFVAENHPMHLHGYNFYVVGDGFGNYDP

Protein Length: 121

Fln nts: CTGTGCCACTGGGGAGACCTGTGAAGGCCCCAACGGAACCAGACTCAGTGCTAGCATGAACAACATATCCTTTACAACGCCCAACATTGCCCTGCTTGAGGCTAATGTTTTCGCAATTAATGATGTTTTTACCACGGATTTTCCATCAGATCCTCCCTTTAAATTCAACTACACGGCGGAGGATATACCCAAAAGACTTTGGGTTCCTGGCTCTGGAACAGAAGTGAAAGTGCTTCGTTACAATTCTACAGTGCAACTGGTTTTTCAGACAACAAACATCTTCGTTGCAGAGAACCATCCCATGCATCTTCATGGTTACAATTTTTACGTGGTGGGGGACGGTTTCGGGAACTATGATCCAGT

Fln Alignment:

Contig33417___CATGETCEGPNGTRLSASMNNISFTTPNIALLEANVFAINDVFTTDFPSDPPFKFNYTAEDIPKRLWVPGSGTEVKVLRYNSTVQLVFQTTNIFVAENHPMHLHGYNFYVVGDGFGNYDP
C0PRA7_______________CETGNTCEGPNGTRLSASMNNVSFVDPTIAILQANYFGINGVFSTDFPSKPPHKFNYTGDDIPRNLWFPLPATKVKVLNYNATVQLVFQSTNIFVAENHPMHLHGYNFYVIGEGFGNYNP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain