SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene31826

Length: 222 nt

UniGene Fasta

>sp_v3.0_unigene31826
AAGGGTATCATTGGTTACACTGATGAAGAAGTTGTCTCAAATGATTTCAAGGGAGATTCCAGATCTTCCATTTTTGATGCTCTTGCTGGAATCCAACTTAACGATAAATTTGTCAAACTTATTTCTTGGTATGACAATGAATGGGGTTACAGTAACAGAGTTATTGACTTGATTCACTATATTTCCCAAAAGAATAATTTTATTAAATCGAGGAATTTATTG

Ace file of the UniGene sp_v3.0_unigene31826

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glyceraldehyde 3-phosphate dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RBN8_RICCO	-	-	1.0e-22	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	77%
Sma3	Glyceraldehyde-3-phosphate dehydrogenase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).	EC:1.2.1.12	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AT1G13440; At1g13440; At1g16300; At1g79530; At1g79530/T8K14_5; At3g04120; CHLREDRAFT_140618; F3O9.10; G3PDH; GAP1a\|GAP1b; GAPC; GAPC1; GAPC2; GAPC3; GAPD1; GAPD4; GAPDH; GAPDH2; GAPDH_1; GPC; GPC1; GPC2; GPC3; GPDA; GSVIVT00002074001; GSVIVT00009717001; G

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrial envelope	GO:0005740	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	acyl carrier activity	GO:0000036	Molecular Function	-
Sma3	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	GO:0004365	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	triose-phosphate isomerase activity	GO:0004807	Molecular Function	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) activity	GO:0043891	Molecular Function	-
Sma3	glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity	GO:0047100	Molecular Function	-
Sma3	NAD binding	GO:0051287	Molecular Function	-
Sma3	glucose metabolic process	GO:0006006	Biological Process	-
Sma3	gluconeogenesis	GO:0006094	Biological Process	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	response to heat	GO:0009408	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to sucrose stimulus	GO:0009744	Biological Process	-
Sma3	reductive pentose-phosphate cycle	GO:0019253	Biological Process	-
Sma3	response to hydrogen peroxide	GO:0042542	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	seed development	GO:0048316	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3		IPR000173	-	-
Sma3	Triosephosphate isomerase	IPR000652	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	Thiolase	IPR002155	-	-
Sma3	Phosphoadenosine phosphosulphate reductase	IPR002500	-	-
Sma3	Phosphopantetheine-binding	IPR006163	-	-
Sma3	Glyceraldehyde-3-phosphate dehydrogenase, type I	IPR006424	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G79530.1	GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 chr1:29916232-29919088 REVERSE LENGTH=422	2.0e-28	77%
RefSeq	Arabidopsis thaliana	NP_178071.1	glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]	3.0e-28	77%
RefSeq	Populus trichocarpa	XP_002298594.1	predicted protein [Populus trichocarpa]	3.0e-28	77%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NLJ7

Fln msg: STOP codon was not found. Distance to subject end: 6 aas, your sequence is shorter than subject: 74 - 209

Fln protein: KGIIGYTDEEVVSNDFKGDSRSSIFDALAGIQLNDKFVKLISWYDNEWGYSNRVIDLIHYISQKNNFIKSRNLL

Protein Length: 75

Fln nts: AAGGGTATCATTGGTTACACTGATGAAGAAGTTGTCTCAAATGATTTCAAGGGAGATTCCAGATCTTCCATTTTTGATGCTCTTGCTGGAATCCAACTTAACGATAAATTTGTCAAACTTATTTCTTGGTATGACAATGAATGGGGTTACAGTAACAGAGTTATTGACTTGATTCACTATATTTCCCAAAAGAATAATTTTATTAAATCGAGGAATTTATTG

Fln Alignment:

Contig31826___KGIIGYTDEEVVSNDFKGDSRSSIFDALAGIQLNDKFVKLISWYDNEWGYSNRVIDLIHYIS
A9NLJ7_______________KGILGYTDEDVVSNDFIGDERSSIFDSKAGIALNTGFVKLISWYDNEWGYSNRVVDLISHMA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain