UniGene Name: sp_v3.0_unigene28456
Length: 194 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene28456
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Myb-related transcription factor (Fragment) n=1 Tax=Rubus idaeus RepID=B8YEK9_RUBID | - | - | 3.0e-19 | 72% |
FL-Next | tr=MYB-like protein; Taxus globosa. | - | - | 0.0 | 70% |
Sma3 | R2r3-myb transcription factor, putative | - | - | 3.67e-20 | - |
Source | Gene names |
---|---|
Sma3 | AIM1; AT4g13480; At1g22640; At2g16720; At2g47460; At3g62610; At4g13480; At5g35550; At5g49330; At5g54230; At5g54230/MDK4.5; B1215B07.15; DcMYB3-1; DcMYB3-2; DcMYB5; F12K8.1; F26K9_40; FcMYB251; FcMYB558; GSVIVT00000055001; GSVIVT00002010001; GSVIVT00002213 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | proanthocyanidin biosynthetic process | GO:0010023 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Myb-related protein P, C-terminal | IPR010588 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47460.1 | MYB12, ATMYB12, PFG1 myb domain protein 12 chr2:19476438-19479242 FORWARD LENGTH=371 | 8.0e-23 | 68% |
RefSeq | Arabidopsis thaliana | NP_182268.1 | transcription factor MYB12 [Arabidopsis thaliana] | 1.0e-22 | 68% |
RefSeq | Populus trichocarpa | XP_002308528.1 | predicted protein [Populus trichocarpa] | 3.0e-24 | 69% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: F8TJT1
Fln msg: Distance to subject end: 181 aas, atg_distance in limit (1-15): atg_distance = 9, W2: There is no M at the beginning, your sequence is shorter than subject: 64 - 250
Fln protein:
K
Protein Length:
65
Fln nts:
A
Fln Alignment:
Contig28456___KDNGHERLNRGSWSAEEDTILSEHIKTHGVGRWTSLPKKAGLKRSGKSCRLRWFNYLRSDIKHG
F8TJT1_______________KDSG---INRGAWTAEEDMILSEYIAIHGDGGWRALPKKAGLKRCGKSCRLRWLNYLRPDIKRG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain