SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene25690

Length: 440 nt

UniGene Fasta

>sp_v3.0_unigene25690
ACAGATCGCATTCTCAAACAGAGCAGATCTATGGCATGCTCGAGAGTTTGGCTGGGCAGATGGAGGAGGCAGGGTATGTGCCAGATACCAACTCTGTACTGCATGATGTTAACGAGGAGGAAAAGAAACACATGGTCTTCTATCACAGTGAGAAACTGGCTATTGCATTTGGAATTATCAGTGTACCCTTTGGCACACCAATACGGGTTATCAAGAATCTTCGCATGTGTGGTGATTGCCACACCGCCACCAAGTTCATCTCCAAGATTGTTAGGCGCGAAATTGTTGTGAGGGATGCCAATAGGTTCCATCATTTTAAAGATGGAGATTGTTCTTGTGGTGATTATTGGTGACACTAAATCAAACTTGTGCCATAAGTGGTGGCGACTTAGATTATTTCTGTCTATTATAAACTTACCGTCGTAGTTTGTGGAGCTAGT

Ace file of the UniGene sp_v3.0_unigene25690

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q9SUH6.1\|PP341_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g30700; AltName: Full=Protein DYW9 emb\|CAB52443.1\| putative protein [Arabidopsis thaliana] emb\|CAB79788	-	-	8.99999e-40	67%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Sma3	Pentatricopeptide repeat protein	-	-	0.0	-

Source	Gene names
Sma3	At1g09410; At1g20230; At1g47580; At1g56690; At2g22070; At2g27610; At2g41080; At3g12770; At3g23330; At3g26782; At3g49170; At3g57430; At3g62890; At4g02750; At4g16835; At4g21065; At4g30700; At4g33170; At4g33990; At4g37380; At5g52630; B1032F05.19; B1080A02.28

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Ribosomal protein S3, C-terminal	IPR001351	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	MAP kinase, conserved site	IPR003527	-	-
Sma3	Domain of unknown function DUF221	IPR003864	-	-
Sma3	K Homology domain, type 2	IPR004044	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3		IPR018115	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT4G30700.1	Pentatricopeptide repeat (PPR) superfamily protein chr4:14962617-14964995 REVERSE LENGTH=792	67%
RefSeq	Arabidopsis thaliana	NP_194799.1	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	67%
RefSeq	Populus trichocarpa	XP_002323422.1	predicted protein [Populus trichocarpa]	66%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AAE0

Fln msg: your sequence is shorter than subject: 117 - 246

Fln protein: RSHSQTEQIYGMLESLAGQMEEAGYVPDTNSVLHDVNEEEKKHMVFYHSEKLAIAFGIISVPFGTPIRVIKNLRMCGDCHTATKFISKIVRREIVVRDANRFHHFKDGDCSCGDYW*

Protein Length: 118

Fln nts: ACAGATCGCATTCTCAAACAGAGCAGATCTATGGCATGCTCGAGAGTTTGGCTGGGCAGATGGAGGAGGCAGGGTATGTGCCAGATACCAACTCTGTACTGCATGATGTTAACGAGGAGGAAAAGAAACACATGGTCTTCTATCACAGTGAGAAACTGGCTATTGCATTTGGAATTATCAGTGTACCCTTTGGCACACCAATACGGGTTATCAAGAATCTTCGCATGTGTGGTGATTGCCACACCGCCACCAAGTTCATCTCCAAGATTGTTAGGCGCGAAATTGTTGTGAGGGATGCCAATAGGTTCCATCATTTTAAAGATGGAGATTGTTCTTGTGGTGATTATTGGTGA___CACTAAATCAAACTTGTGCCATAAGTGGTGGCGACTTAGATTATTTCTGTCTATTATAAACTTACCGTCGTAGTTTGTGGAGCTAGT

Fln Alignment:

Contig25690___RSHSQTEQIYGMLESLAGQMEEAGYVPDTNSVLHDVNEEEKKHMVFYHSEKLAIAFGIISVPFGTPIRVIKNLRMCGDCHTATKFISKIVRREIVVRDANRFHHFKDGDCSCGDYW
D5AAE0_______________KSHPQTEEIYSTLEELARQMEAAGYVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain