SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene24578

Length: 447 nt

UniGene Fasta

>sp_v3.0_unigene24578
ATTTGGTCCTCAACCTAGGAACCTTGAAGAGCCTGAGAGGATTTTTGGGTCTCACAAACTATTATCGCAAATTTGTCCGCAATTATGGTCGCATAGCGAAGCCCCTCGCTCAACTCCTGAAGAAAAATTCATTCTTCTGGAATGAGGACGCACAACAGGCCTTTATAGCTCTCAAAAATGCCATGTGTTCCACTCTAGTCTTAACACTACCTGATTTCACCAAATCTTTTGTCATTGAATGTGATGCTTCGGGTACGGGTATTGGGGCGGTCTTAATGCAGGAAGGATGACCTTTGGCCTTCACAAGTCAACAATTAAGTGGGAAGAATCTGGGCCAATCTACCTACGAGAAGGAAATGATGGCCATCTTACATGCAGTAGAGACCTGGCGACCTTACTTATTGGGGCGAGTTCCCAAATCCGCACAGACCATCACAGTCTTAAATA

Ace file of the UniGene sp_v3.0_unigene24578

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold n=1 Tax=Medicago truncatula RepID=A2Q2C7_MEDTR	-	-	7.0e-40	59%
FL-Next	sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion.	-	-	0.0	61%
Sma3	Retrotransposon protein, putative, unclassified	-	-	1.873e-17	-

Source	Gene names
Sma3	AT4g07850; B1234D02.7; F23H6.1; F5K24.1; H0124B04.16; H0201G08.12; H0211A12.9; H0321H01.8; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g13350; LOC_Os03g26020; LOC_Os03g35326; LOC_Os03g61190; LOC_Os10g13960; LOC_Os10g16560; LOC_Os10g16880; LOC_Os10g20440; LOC_

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	carbonate dehydratase activity	GO:0004089	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	triglyceride lipase activity	GO:0004806	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	carbon utilization	GO:0015976	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Ribosomal protein S15	IPR000589	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Protein translocase complex, SecE/Sec61-gamma subunit	IPR001901	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Lipase, class 3	IPR002921	-	-
Sma3	Intron-encoded nuclease 2	IPR003611	-	-
Sma3	Exostosin-like	IPR004263	-	-
Sma3	FAR1 DNA binding domain	IPR004330	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	FBD	IPR006566	-	-
Sma3	Protein of unknown function DUF594	IPR007658	-	-
Sma3	S15/NS1, RNA-binding	IPR009068	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	ATMG00860.1	ORF158 DNA/RNA polymerases superfamily protein chrM:235916-236392 FORWARD LENGTH=158	3.0e-20	61%
RefSeq	Arabidopsis thaliana	NP_085542.1	hypothetical protein ArthMp075 (mitochondrion) [Arabidopsis thaliana]	4.0e-20	61%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: sp_plants

Fln subject: P92523

Fln msg: your sequence is shorter than subject: 96 - 158

Fln protein: LVLNLGTLKSLRGFLGLTNYYRKFVRNYGRIAKPLAQLLKKNSFFWNEDAQQAFIALKNAMCSTLVLTLPDFTKSFVIECDASGTGIGAVLMQEG*

Protein Length: 97

Fln nts: ATTTGGTCCTCAACCTAGGAACCTTGAAGAGCCTGAGAGGATTTTTGGGTCTCACAAACTATTATCGCAAATTTGTCCGCAATTATGGTCGCATAGCGAAGCCCCTCGCTCAACTCCTGAAGAAAAATTCATTCTTCTGGAATGAGGACGCACAACAGGCCTTTATAGCTCTCAAAAATGCCATGTGTTCCACTCTAGTCTTAACACTACCTGATTTCACCAAATCTTTTGTCATTGAATGTGATGCTTCGGGTACGGGTATTGGGGCGGTCTTAATGCAGGAAGGATGA___CCTTTGGCCTTCACAAGTCAACAATTAAGTGGGAAGAATCTGGGCCAATCTACCTACGAGAAGGAAATGATGGCCATCTTACATGCAGTAGAGACCTGGCGACCTTACTTATTGGGGCGAGTTCCCAAATCCGCACAGACCATCACAGTCTTAAATA

Fln Alignment:

Contig24578___LRGFLGLTNYYRKFVRNYGRIAKPLAQLLKKNSFFWNEDAQQAFIALKNAMCSTLVLTLPDFTKSFV
P92523_______________LRGFLGLTGYYRRFVKNYGKIVRPLTELLKKNSLKWTEMAALAFKALKGAVTTLPVLALPDLKLPFV

SNPs (tot: 3)

Position	A %	C %	G %	T %	Probability
172		75		25	0.996473
197		25		75	0.996473
205	75		25		0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain