SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene21774

Length: 374 nt

UniGene Fasta

>sp_v3.0_unigene21774
AATACAAGGCCAGGCTTGTGGCTAAGGGGTATGCTCAAAAGGAAGGGATTAACTATGAGGAAACCTATGCCCCAGTAGCCAAGTATACATCTATTAGGACCGTGATATCTCTTGCAGCCCAGATGGGATGGGAGATTGATCAGATGGATGTCAAGACGGCGTTTTTGAACGGGGTAATAGAAGAAGAGGTATACATTGAACAACCAGAGTGCTTTGAAACTCATGAGAAGAAGTCTCATGTATGCAGACTGGAGAAAGCCTTGTATGGGCTGAAGCAGGCACCGAGAGCGTGGTATGGTCGGATAGATGGCTACTTGCAAAAGATGGGGTTTGTCAAGAGTGATCTGTTGAAGTTTCTAAGTTTACTTAGTTTA

Ace file of the UniGene sp_v3.0_unigene21774

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Reverse transcriptase (Fragment) n=1 Tax=Picea abies RepID=Q9FY10_PICAB	-	-	9.0e-39	72%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	57%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	0.0	-

Source	Gene names
Sma3	AP2_E11.1; AT4g02960; AT4g04440; AT4g16870; At1g44510; At2g05390; At2g07550; At2g15650; At2g17490; AtRE2; AtRE2-1; B1003C08.12; B1065G12.28; B1110B01.4; F11I4_21; F28L22.3; F9K21.100; Fourf gag/pol; H0306F03.15; H0413E07.4; LOC_Os03g01684; LOC_Os03g05850;

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	dihydrofolate reductase activity	GO:0004146	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	exonuclease activity	GO:0004527	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	peptidase activity	GO:0008233	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	glycine biosynthetic process	GO:0006545	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	nucleotide biosynthetic process	GO:0009165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dihydrofolate reductase domain	IPR001796	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	Putative 5-3 exonuclease	IPR004859	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Uncharacterised protein family Cys-rich	IPR006461	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3		IPR010256	-	-
Sma3	CCT domain	IPR010402	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Dihydrofolate reductase	IPR012259	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	F-box associated interaction domain	IPR017451	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Distance to subject end: 195 aas, your sequence is shorter than subject: 124 - 363

Fln protein: YKARLVAKGYAQKEGINYEETYAPVAKYTSIRTVISLAAQMGWEIDQMDVKTAFLNGVIEEEVYIEQPECFETHEKKSHVCRLEKALYGLKQAPRAWYGRIDGYLQKMGFVKSDLLKFLSLLSL

Protein Length: 125

Fln nts: AATACAAGGCCAGGCTTGTGGCTAAGGGGTATGCTCAAAAGGAAGGGATTAACTATGAGGAAACCTATGCCCCAGTAGCCAAGTATACATCTATTAGGACCGTGATATCTCTTGCAGCCCAGATGGGATGGGAGATTGATCAGATGGATGTCAAGACGGCGTTTTTGAACGGGGTAATAGAAGAAGAGGTATACATTGAACAACCAGAGTGCTTTGAAACTCATGAGAAGAAGTCTCATGTATGCAGACTGGAGAAAGCCTTGTATGGGCTGAAGCAGGCACCGAGAGCGTGGTATGGTCGGATAGATGGCTACTTGCAAAAGATGGGGTTTGTCAAGAGTGATCTGTTGAAGTTTCTAAGTTTACTTAGTTTA

Fln Alignment:

Contig21774___YKARLVAKGYAQKEGINYEETYAPVAKYTSIRTVISLAAQMGWEIDQMDVKTAFLNGVIEEEVYIEQPECFETHEKKSHVCRLEKALYGLKQAPRAWYGRIDGYLQKMGFV
B8LKV8_______________HKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQPPRYEVRGQEDKVYRLKKALNGLKQAPRAWYSKIDSYMIKNEFI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain