UniGene Name: sp_v3.0_unigene19109
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene19109
A |
Ace file of the UniGene sp_v3.0_unigene19109 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein serine/threonine kinase BNK1 [Brassica napus] | - | - | 5.0e-33 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Receptor serine-threonine protein kinase, putative | - | - | 5.376e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.478e-21 | - |
Source | Gene names |
---|---|
Sma3 | 673I14.2; AT1G67720; AT4g13190; At1g07870; At1g20650; At1g24030; At1g76370; At2g17220; At2g17220/T23A1.8; At2g28590; At3g02810; At3g07070; At3g20530; At3g24790; At3g26940; At4g13190; At5g02290; At5g02800; At5g16500; At5g18610; B1130E07.8; B1331F11.28; CDG |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0197 | IPR007915 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G02800.1 | Protein kinase superfamily protein chr5:635545-637374 REVERSE LENGTH=378 | 4.99983e-42 | 90% |
RefSeq | Arabidopsis thaliana | NP_195900.2 | protein kinase family protein [Arabidopsis thaliana] | 6.99949e-42 | 90% |
RefSeq | Populus trichocarpa | XP_002312759.1 | serine/threonine protein kinase PBS1, partial [Populus trichocarpa] | 1.00053e-42 | 93% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAA3
Fln msg: Distance to subject end: 249 aas, your sequence is shorter than subject: 73 - 458
Fln protein:
F
Protein Length:
74
Fln nts:
A
Fln Alignment:
Contig19109___FLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMQLGSLENHLHDLAPDKEPLDWNTRMKIAAGAARGLEY
D5AAA3_______________FLVEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDLPPDKEPLDWKTRMKIAAGAAKGLEY
SNPs (tot: 1) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
58 | 33 | 66 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain