SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene18719

Length: 493 nt

UniGene Fasta

>sp_v3.0_unigene18719
CGTCGTGACCTTGGCTGTCACTCAATTATGAAGTGAAGTGAGTTTTTCCCTCCCGTTTCTGCCACTCAGACGTTTGTTCTTTCATTGAACTCACGTTTGTTCATTCATTATTAATCCATTTGCGGGGAAGATCTCCATGGCTTCCAGAAATAGACAAGGCGATGTTAATCAACAGAGAGGTAATGTCATTTCCGCCGAGGAAGTCCATTACAGAGGCGTGAGAAAAAGGCCGTGGGGAAAATACGCCGCAGAAATCAAAGACCCCTTCAGTAAAAATCGGTTGTGGCTGGGCTCATTTGCTACGGCCGAGGAAGCAGCCAAAGAATATGACGAAGCCGCGAGATATTTGAGAGGACCAAGAACGAAAACTAACTTTCCTGCTCGCCCCGTCGACTTTGTCCACGAAATAGGCCAGACCTGCACCACCCAAACCAGCAGCGCCGCACTCGACTCCCGGACTCCCTCCTCCACTGCCACCACCGCCTTCCTTCGC

Ace file of the UniGene sp_v3.0_unigene18719

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Ethylene responsive element binding protein C1 n=1 Tax=Capsicum annuum RepID=Q32W75_CAPAN	-	-	1.0e-15	40%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	66%
Sma3	AP2/ERF domain-containing transcription factor	-	-	4.846e-29	-

Source	Gene names
Sma3	ATF2; At1g03800; At1g12980; At1g24590; At1g28360; At1g28370; At1g50640; At1g53170; At2g33710; At2g46310; At3g15210; At3g16770; At3g20310; At4g11140; At4g27950; At4g34410; At5g13330; At5g13910; At5g44210; B0811B10.20; BIERF2; CGLD5B; CHLREDRAFT_205920; CRF

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nuclear body	GO:0016604	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	cadmium ion binding	GO:0046870	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	-
Sma3	induced systemic resistance, jasmonic acid mediated signaling pathway	GO:0009864	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	embryonic pattern specification	GO:0009880	Biological Process	-
Sma3	positive regulation of seed germination	GO:0010030	Biological Process	-
Sma3	specification of organ axis polarity	GO:0010084	Biological Process	-
Sma3	negative regulation of ethylene mediated signaling pathway	GO:0010105	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	transcription factor import into nucleus	GO:0042991	Biological Process	-
Sma3	leaf development	GO:0048366	Biological Process	-
Sma3	cotyledon development	GO:0048825	Biological Process	-
Sma3	regulation of cell cycle	GO:0051726	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	AP2/ERF domain	IPR001471	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Ubiquinol cytochrome reductase, transmembrane domain	IPR004192	-	-
Sma3	Rieske iron-sulphur protein, C-terminal	IPR005805	-	-
Sma3		IPR005806	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Ubiquinol-cytochrome c reductase, iron-sulphur subunit	IPR006317	-	-
Sma3	Rieske iron-sulphur protein	IPR014349	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3	Rieske [2Fe-2S] iron-sulphur domain	IPR017941	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G28360.1	ERF12, ATERF12 ERF domain protein 12 chr1:9951934-9952503 FORWARD LENGTH=189	2.0e-19	71%
RefSeq	Arabidopsis thaliana	NP_174158.1	ethylene-responsive transcription factor 12 [Arabidopsis thaliana]	3.0e-19	71%
RefSeq	Populus trichocarpa	XP_002305780.1	AP2/ERF domain-containing transcription factor [Populus trichocarpa]	3.0e-19	55%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5A9F4

Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 119 - 189

Fln protein: MASRNRQGDVNQQRGNVISAEEVHYRGVRKRPWGKYAAEIKDPFSKNRLWLGSFATAEEAAKEYDEAARYLRGPRTKTNFPARPVDFVHEIGQTCTTQTSSAALDSRTPSSTATTAFLR

Protein Length: 120

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTATGAAGTGAAGTGAGTTTTTCCCTCCCGTTTCTGCCACTCAGACGTTTGTTCTTTCATTGAACTCACGTTTGTTCATTCATTATTAATCCATTTGCGGGGAAGATCTCC_-_ATGGCTTCCAGAAATAGACAAGGCGATGTTAATCAACAGAGAGGTAATGTCATTTCCGCCGAGGAAGTCCATTACAGAGGCGTGAGAAAAAGGCCGTGGGGAAAATACGCCGCAGAAATCAAAGACCCCTTCAGTAAAAATCGGTTGTGGCTGGGCTCATTTGCTACGGCCGAGGAAGCAGCCAAAGAATATGACGAAGCCGCGAGATATTTGAGAGGACCAAGAACGAAAACTAACTTTCCTGCTCGCCCCGTCGACTTTGTCCACGAAATAGGCCAGACCTGCACCACCCAAACCAGCAGCGCCGCACTCGACTCCCGGACTCCCTCCTCCACTGCCACCACCGCCTTCCTTCGC

Fln Alignment:

Contig18719___SAEEVHYRGVRKRPWGKYAAEIKDPFSKNRLWLGSFXXXXXXXXXXXXXXRYLRGPRTKTNF
D5A9F4_______________AVKETHFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDTAEDAARAYDDAARALRGPKAKTNF

SNPs (tot: 20)

Position	A %	C %	G %	T %	Probability
45		42		57	1.0
46			42	57	1.0
49		57	42		1.0
50		57		42	1.0
51			42	57	1.0
52	42	57			1.0
55			66	33	1.0
57			33	66	1.0
58			33	66	1.0
60		22		77	0.999999
62		66		33	1.0
70	77		22		0.999999
74	22			77	0.999999
160		88		11	0.999952
170		88	11		0.999952
173		88	11		0.999952
197		11	88		0.999952
280		20	80		0.999996
331		87		12	0.992554
417		66	33		0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain