UniGene Name: sp_v3.0_unigene16687
Length: 221 nt
![]() |
---|
>sp_v3.0_unigene16687
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative stage III sporulation protein AA [Arabidopsis thaliana] dbj|BAF00902.1| hypothetical protein [Arabidopsis thaliana] gb|AEE31582.1| putative stage III sporulation protein AA [Arabidopsis thaliana] | - | - | 1.0e-26 | 82% |
FL-Next | sp=Uncharacterized protein ycf45; Porphyra purpurea. Plastid; Chloroplast. | - | - | 0.0 | 69% |
Sma3 | Stage III sporulation protein AA, putative | - | - | 2.673e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT1G33290; At1g33290; At1g73170; At3g10420; CHLREDRAFT_107111; CHLREDRAFT_108035; CHLREDRAFT_118675; F13M14.30; GSVIVT00018119001; GSVIVT00027784001; GSVIVT00031962001; Grc000110; Heak293_Cp042; LOC_Os12g10640; MICPUCDRAFT_35564; MICPUCDRAFT_52805; MICPUN |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Single-stranded nucleic acid binding R3H | IPR001374 | - | 0.0 | - |
Sma3 | IPR001984 | - | 0.0 | - | |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
Sma3 | IPR015465 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G33290.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr1:12074125-12075989 FORWARD LENGTH=379 | 3.0e-34 | 82% |
RefSeq | Arabidopsis thaliana | NP_849744.1 | putative stage III sporulation protein AA [Arabidopsis thaliana] | 1.0e-34 | 82% |
RefSeq | Populus trichocarpa | XP_002315329.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-25 | 65% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P51281
Fln msg: Distance to subject end: 413 aas, your sequence is shorter than subject: 73 - 565
Fln protein:
C
Protein Length:
74
Fln nts:
A
Fln Alignment:
Contig16687___IEGTLHRISAVRSRKGVIVGLTCRVGRAVTGHVDMVRDLLPYGESILFLGRPGVGKTTVMREIARVLADEL
P51281_______________IEKTLHRISSMRNREGSIIGLTCRVGRAVFGTISIIRDLLEQGDSILLLGKPGVGKTTAVREIARVLSDEM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain