UniGene Name: sp_v3.0_unigene16370
Length: 247 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene16370
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LW63.1|PP251_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g23330 dbj|BAB02277.1| unnamed protein product [Arabidopsis thaliana] gb|AEE76753.1| pentatric | - | - | 1.0e-18 | 52% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Source | Gene names |
---|---|
Sma3 | At1g20230; At2g02980; At3g23330; GSVIVT00000114001; GSVIVT00004236001; GSVIVT00004796001; GSVIVT00007101001; GSVIVT00007171001; GSVIVT00007631001; GSVIVT00017181001; GSVIVT00017247001; GSVIVT00017804001; GSVIVT00018296001; GSVIVT00019609001; GSVIVT0002086 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Sodium/calcium exchanger membrane region | IPR004837 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF629 | IPR006865 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF627, N-terminal | IPR006866 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23330.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr3:8347200-8349347 FORWARD LENGTH=715 | 8.0e-24 | 52% |
RefSeq | Arabidopsis thaliana | NP_188975.3 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-23 | 52% |
RefSeq | Populus trichocarpa | XP_002316137.1 | predicted protein [Populus trichocarpa] | 9.0e-22 | 55% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 147 aas, atg_distance in limit (1-15): atg_distance = 4, W2: There is no M at the beginning, your sequence is shorter than subject: 82 - 232
Fln protein:
G
Protein Length:
83
Fln nts:
A
Fln Alignment:
Contig16370___GYAQRGHGDEALKLFRQMCVAGVKPNSMTITSVLSACARLSALKLGKEIHRYIIKFWLESHVFVGSALIDMYSKCGSI
D5AB53_______________GYAQNGYFDEALKLFQRMQLTKVKPNAETFPSVLPACANLAALEPGKVLHLYIIKSGFESDVFVGSTLIDMYAKCSSI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain