SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene15484

Length: 477 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene15484
GACACTCCTAGTGTGGTCACTGGCTACCCTGCTGACAAGCTTGATGAGGCCCTTGATGGCGTCCAAGTCGTCGTTATCCCTGCTGGCGTTCCGAGGAAGCCCGGTTGACGCGTGACGATCTATTTAATACCAATGCTTCCATCGTCCGCGACCTCGCGGCCGCAATCGGTCGTGTGGCCCCTACTGCACACATCCTTGTCATTTCAAATCCTGTCAACTCGACTGTCCCCATTGTTGCATCTACCCTCAAGAAGCTTGGGGTCTACAATCCCGCACGCCTGTTTGGTGTGACCACCCTTGATGTCGTCCGCGCCGCTCGCTTTACGGCTGGCATTGCAGGCGCTAAGCCTGCGGATACTCCCATAACCGTTGTCGGTGGGCACAGTGGCGCGACTATCGTCCCTTTGCTTTCGCAAAATACACACGGAAAGGCTATTTCAGGCGATGTTTACAATGCTCTTGTCAACCGCATCCAGT

Ace file of the UniGene sp_v3.0_unigene15484 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Malate dehydrogenase n=1 Tax=Schizophyllum commune H4-8 RepID=D8QLH9_SCHCM	-	-	75%
FL-Next	sp=Malate dehydrogenase; Sequoia sempervirens (California redwood) (Taxodium sempervirens).	-	-	52%
Sma3	Malate dehydrogenase	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Malate dehydrogenase.	EC:1.1.1.37	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Citrate cycle (TCA cycle)	00020	%
Sma3	Pyruvate metabolism	00620	%
Sma3	Glyoxylate and dicarboxylate metabolism	00630	%
Sma3	Methane metabolism	00680	%
Sma3	Carbon fixation in photosynthetic organisms	00710	%
Sma3	Carbon fixation pathways in prokaryotes	00720	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AT3G47520; At1g53240; At2g22780; At3g15020; At3g47520; At5g09660; B1088C09.38; CHLREDRAFT_126023; CHLREDRAFT_137163; CHLREDRAFT_60444; F12M16.14; F17I14_150; F1P2.70; GSVIVT00010647001; GSVIVT00016329001; GSVIVT00020972001; GSVIVT00027787001; GSVIVT000359

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	mitochondrial matrix	GO:0005759	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	glyoxysome	GO:0009514	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	L-malate dehydrogenase activity	GO:0030060	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	glyoxylate cycle	GO:0006097	Biological Process	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	malate metabolic process	GO:0006108	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	regulation of fatty acid beta-oxidation	GO:0031998	Biological Process	-
Sma3	defense response to bacterium	GO:0042742	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Major intrinsic protein	IPR000425	-	-
Sma3	Lactate/malate dehydrogenase, N-terminal	IPR001236	-	-
Sma3	Malate dehydrogenase, active site	IPR001252	-	-
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	L-lactate/malate dehydrogenase	IPR001557	-	-
Sma3	Malate dehydrogenase, type 1	IPR010097	-	-
Sma3	Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal	IPR015955	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G53240.1	mMDH1 Lactate/malate dehydrogenase family protein chr1:19854966-19856802 REVERSE LENGTH=341	2.0e-37	54%
RefSeq	Arabidopsis thaliana	NP_564625.1	malate dehydrogenase 1 [Arabidopsis thaliana]	2.0e-37	54%
RefSeq	Populus trichocarpa	XP_002300420.1	predicted protein [Populus trichocarpa]	3.0e-38	56%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: E5FXB1

Fln msg: Overlapping hits, possible frame ERROR between 105 and 105, Distance to subject end: 105 aas, your sequence is shorter than subject: 159 - 354

Fln protein: DTPSVVTGYPADKLDEALDGVQVVVIPAGVPRKPxxTRDDLFNTNASIVRDLAAAIGRVAPTAHILVISNPVNSTVPIVASTLKKLGVYNPARLFGVTTLDVVRAARFTAGIAGAKPADTPITVVGGHSGATIVPLLSQNTHGKAISGDVYNALVNRIQ

Protein Length: 160

Fln nts: GACACTCCTAGTGTGGTCACTGGCTACCCTGCTGACAAGCTTGATGAGGCCCTTGATGGCGTCCAAGTCGTCGTTATCCCTGCTGGCGTTCCGAGGAAGCCCxxxxxxACGCGTGACGATCTATTTAATACCAATGCTTCCATCGTCCGCGACCTCGCGGCCGCAATCGGTCGTGTGGCCCCTACTGCACACATCCTTGTCATTTCAAATCCTGTCAACTCGACTGTCCCCATTGTTGCATCTACCCTCAAGAAGCTTGGGGTCTACAATCCCGCACGCCTGTTTGGTGTGACCACCCTTGATGTCGTCCGCGCCGCTCGCTTTACGGCTGGCATTGCAGGCGCTAAGCCTGCGGATACTCCCATAACCGTTGTCGGTGGGCACAGTGGCGCGACTATCGTCCCTTTGCTTTCGCAAAATACACACGGAAAGGCTATTTCAGGCGATGTTTACAATGCTCTTGTCAACCGCATCCAGT

Fln Alignment:

Contig15484___DTPSVVTGYPA-DKLDEALDGVQVVVIPAGVPRKPGLTRDDLFNTNASIVRDLAAAIGRVAPTAHILVISNPVNSTVPIVASTLKKLGVYNPARLFGVTTLDVVRAARFTAGIAGAKPADTPITVVGGHSGATIVPLLSQNTHGKAISGDVYNALVNRIQ
E5FXB1_______________DTSTVVRGFLGKEQLEDALVGMDLVIIPAGIPRKPGMTRDDLFKINAGIVRTLCEGVAKCCPNALLNIISNPVNSTVPIAAEVLKKAGVYNPKRLLGVTTLDVVRANTFVAEVVGVDPKDIDVPVVGGHAGITILPLLSQVNPRFSFTNEEIEYLTNRIQ

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain