SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene15303

Length: 371 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene15303
GTAGTGTCCAGTCATATCTACCAAAGTTGTGGCTTGAGTAGATTGGCACTGGCAGTGAAATGGTGGGGTCAATCCACTGCAAGCAATACCAAAAAGCAGAAGCCATCAAAGTGGCCAAAGCTTGAGACAAAATGGCATACAAAGTTGTTCGTTCTGTGGGTGCTGGTTGCAGCAATAGTCTCTATGTGGATTTTCTATTCCATGGATTATGACATTATAGAACGTCGCAAAGAAACATTGGCAAGCATGTGCGATGAGCGTGCAAGAATGCTGCAGGACCAGTTTTCCGTGAGCATGAATCATGTGCATGCTTTGGCTATTTTAGTTTCTACTTTCCATCACAGGAAGCATCCTCGGATATTGATCAGGTT

Ace file of the UniGene sp_v3.0_unigene15303 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	TPA: histidine kinase [Oryza sativa Japonica Group]	-	-	4.0e-22	64%
FL-Next	sp=Histidine kinase 3; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	60%
Sma3	Histidine kinase cytokinin receptor	-	-	4.129e-17	-

Source	Gene names
Sma3	AHK3; AHK4; At1g27320; At2g01830; CHARK; CKR1; CRE1; CRE1A; CRE1B; GSVIVT00002792001; GSVIVT00029130001; GSVIVT00030632001; HK1; HK2; HK3; HK3A; HK3B; LOC_Os10g21810; LOC_Os12g26940; OHK2; OHK3; OHK3b; OSJNBa0073L01.1; Os10g0362300; Os12g0454800; OsI_0498

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	two-component sensor activity	GO:0000155	Molecular Function	-
Sma3	two-component response regulator activity	GO:0000156	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	osmosensor activity	GO:0005034	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	cytokinin receptor activity	GO:0009884	Molecular Function	-
Sma3	kinase activity	GO:0016301	Molecular Function	-
Sma3	two-component signal transduction system (phosphorelay)	GO:0000160	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	regulation of seed germination	GO:0010029	Biological Process	-
Sma3	leaf senescence	GO:0010150	Biological Process	-
Sma3	regulation of chlorophyll catabolic process	GO:0010271	Biological Process	-
Sma3	peptidyl-histidine phosphorylation	GO:0018106	Biological Process	-
Sma3	regulation of shoot development	GO:0048831	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Signal transduction response regulator, receiver domain	IPR001789	-	-
Sma3	ATPase-like, ATP-binding domain	IPR003594	-	-
Sma3	Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain	IPR003661	-	-
Sma3	Signal transduction histidine kinase-related protein, C-terminal	IPR004358	-	-
Sma3	Signal transduction histidine kinase, core	IPR005467	-	-
Sma3	CHASE	IPR006189	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3		IPR017442	-	-
Sma3	Glycoside hydrolase, family 5, conserved site	IPR018087	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G27320.1	AHK3, HK3 histidine kinase 3 chr1:9487780-9492027 FORWARD LENGTH=1036	4.0e-26	60%
RefSeq	Arabidopsis thaliana	NP_564276.1	histidine kinase 3 [Arabidopsis thaliana]	6.0e-26	60%
RefSeq	Populus trichocarpa	XP_002321181.1	histidine kinase cytokinin receptor [Populus trichocarpa]	2.0e-29	65%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9C5U1

Fln msg: Distance to subject end: 866 aas, your sequence is shorter than subject: 123 - 1036

Fln protein: VVSSHIYQSCGLSRLALAVKWWGQSTASNTKKQKPSKWPKLETKWHTKLFVLWVLVAAIVSMWIFYSMDYDIIERRKETLASMCDERARMLQDQFSVSMNHVHALAILVSTFHHRKHPRILIR

Protein Length: 124

Fln nts: GTAGTGTCCAGTCATATCTACCAAAGTTGTGGCTTGAGTAGATTGGCACTGGCAGTGAAATGGTGGGGTCAATCCACTGCAAGCAATACCAAAAAGCAGAAGCCATCAAAGTGGCCAAAGCTTGAGACAAAATGGCATACAAAGTTGTTCGTTCTGTGGGTGCTGGTTGCAGCAATAGTCTCTATGTGGATTTTCTATTCCATGGATTATGACATTATAGAACGTCGCAAAGAAACATTGGCAAGCATGTGCGATGAGCGTGCAAGAATGCTGCAGGACCAGTTTTCCGTGAGCATGAATCATGTGCATGCTTTGGCTATTTTAGTTTCTACTTTCCATCACAGGAAGCATCCTCGGATATTGATCAGGTT

Fln Alignment:

Contig15303___KLETKWHTKLFVLWVLVAAIVSMWIFYSMDYDIIERRKETLASMCDERARMLQDQFSVSMNHVHALAILVSTFHHRKHP
Q9C5U1_______________KFNKAWWRKLVVVWVVFWVLVSIWTFWYFSSQAMEKRKETLASMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKIP

SNPs (tot: 3)

Position	A %	C %	G %	T %	Probability
172		20		80	0.995493
173	20		80		0.995493
174			80	20	0.995493

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain