UniGene Name: sp_v3.0_unigene15135
Length: 246 nt
![]() |
---|
>sp_v3.0_unigene15135
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor-like protein kinase 2 [Oryza sativa Japonica Group] | - | - | 1.0e-21 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 48% |
Sma3 | Receptor protein kinase-like | - | - | 1.858e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.316e-07 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.606e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT1G67720; AT1G79620; AT4g00330; AT5G48740; AT5G49760; AT5G49770; A_IG005I10.8; At1g79620; At1g79620/F20B17_5; At3g04690; At4g00330; At5g01950; At5g28680; At5g49760; At5g49760/K2I5_13; At5g49780; B1148D12.10; DMI2; F4H5.8; F4P12_290; F5I10.8; F7O18.16; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G49760.1 | Leucine-rich repeat protein kinase family protein chr5:20216679-20221052 FORWARD LENGTH=953 | 8.0e-26 | 76% |
RefSeq | Arabidopsis thaliana | NP_199787.2 | leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] | 1.0e-25 | 76% |
RefSeq | Populus trichocarpa | XP_002323702.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-28 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9B2
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 81 - 338
Fln protein:
C
Protein Length:
82
Fln nts:
A
Fln Alignment:
Contig15135___GHAGHVSTQVKGTMGYLDPEYYMTQQLTQKSDVYSFGVVLLEILASRQPLVERGKYLVQEVKTAMDRDGINAIR
D5A9B2_______________GDSQVISTQIAGTLGYLDPEYLSTGQLSLNSDVYSFGVLLLELITARPAREATGGLLVTVVKTSLETWGISVLK
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
136 | 20 | 80 | 0.995493 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain