SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene13687

Length: 539 nt

UniGene Fasta

>sp_v3.0_unigene13687
CCTCAGGAGCTTATGAATTTGAATAAACTCAATTATCTCTACCTAGCTGCCTGCAATCTGGTGGGACAGATTCCGAGTTCTATTCTGAACTTAACAGATCTGGGTCTTCTAGATCTTTCTAGCAATTACCTGAATGGATCTATTCCAAGTGGAATTTCCAAACTCAAAAACATCTACCAACTGGAGCTCTACAATAACAATCTCAGTGGAAACATACCTCGAGAGCTGGGTAATCTCACATTTCTGAAATTATTTGATGCATCAAAGAACATGCTCAGTGGAAACATTCCAGAGGAAATTGGTAATCTGAGAAACCTCGTTTCCTTCGAGGCCCACACGAACCAACTGACTGGCCAAATTCCCGAAAGCATTGGGGAGTTACAATATCTTGAAGGTTTATCATTGTATAACAACAATTTGACAGGTCAACTACCACAGAAACTTGGCAGTCTATCCAAGTTTAATTTGCTCGATGTCTCTGAAAACCAGCTTAATGGCGCGCTGCCAAGAGATATGTGCAGAGGAGGAAATCTGCAATA

Ace file of the UniGene sp_v3.0_unigene13687

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	leucine-rich receptor-like protein kinase [Arabidopsis thaliana] gb\|AAL32758.1\| Unknown protein [Arabidopsis thaliana] gb\|ACN59227.1\| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gb\|AEE28522.1\| leucine-rich receptor-like protein	-	-	9.0e-32	51%
FL-Next	tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	48%
Sma3	Receptor protein kinase CLAVATA1, putative	-	-	8.201e-18	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	1.232e-17	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	3.191e-15	-
Sma3		EC:2.7.11.3-	-	1.096e-07	-

Source	Gene names
Sma3	AT1G28440; AT1G75820; AT4G28490; AT4g20270; AT5G25930; AT5G49660; AT5G65700; AT5G65710; At1g09970; At1g09970/F21M12.36; At1g28440; At1g72180; At1g75820; At3g19700; At4g20270; At4g28490; At5g25910; At5g25930; At5g49660; At5g49660/MNI5_4; At5g65700; CLV; CL

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	aminopeptidase activity	GO:0004177	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	kinase activity	GO:0016301	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	regulation of meristem structural organization	GO:0009934	Biological Process	-
Sma3	endosperm development	GO:0009960	Biological Process	-
Sma3	regulation of meristem growth	GO:0010075	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	microsporocyte differentiation	GO:0010480	Biological Process	-
Sma3	cell differentiation	GO:0030154	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-
Sma3	gametophyte development	GO:0048229	Biological Process	-
Sma3	floral organ development	GO:0048437	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Alpha/beta hydrolase fold-1	IPR000073	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Peptidase S33	IPR002410	-	-
Sma3	Leucine-rich repeat, typical subtype	IPR003591	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Proline iminopeptidase	IPR005944	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Domain of unknown function DUF1618	IPR011676	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G09970.2	LRR XI-23, RLK7 Leucine-rich receptor-like protein kinase family protein chr1:3252408-3255428 FORWARD LENGTH=977	2.0e-37	51%
RefSeq	Arabidopsis thaliana	NP_850942.1	leucine-rich receptor-like protein kinase [Arabidopsis thaliana]	2.0e-37	51%
RefSeq	Populus trichocarpa	XP_002313944.1	predicted protein [Populus trichocarpa]	9.0e-39	55%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q19AV8

Fln msg: Distance to subject end: 613 aas, your sequence is shorter than subject: 179 - 998

Fln protein: PQELMNLNKLNYLYLAACNLVGQIPSSILNLTDLGLLDLSSNYLNGSIPSGISKLKNIYQLELYNNNLSGNIPRELGNLTFLKLFDASKNMLSGNIPEEIGNLRNLVSFEAHTNQLTGQIPESIGELQYLEGLSLYNNNLTGQLPQKLGSLSKFNLLDVSENQLNGALPRDMCRGGNLQ

Protein Length: 180

Fln nts: CCTCAGGAGCTTATGAATTTGAATAAACTCAATTATCTCTACCTAGCTGCCTGCAATCTGGTGGGACAGATTCCGAGTTCTATTCTGAACTTAACAGATCTGGGTCTTCTAGATCTTTCTAGCAATTACCTGAATGGATCTATTCCAAGTGGAATTTCCAAACTCAAAAACATCTACCAACTGGAGCTCTACAATAACAATCTCAGTGGAAACATACCTCGAGAGCTGGGTAATCTCACATTTCTGAAATTATTTGATGCATCAAAGAACATGCTCAGTGGAAACATTCCAGAGGAAATTGGTAATCTGAGAAACCTCGTTTCCTTCGAGGCCCACACGAACCAACTGACTGGCCAAATTCCCGAAAGCATTGGGGAGTTACAATATCTTGAAGGTTTATCATTGTATAACAACAATTTGACAGGTCAACTACCACAGAAACTTGGCAGTCTATCCAAGTTTAATTTGCTCGATGTCTCTGAAAACCAGCTTAATGGCGCGCTGCCAAGAGATATGTGCAGAGGAGGAAATCTGCAATA

Fln Alignment:

Contig13687___VGQIPXXXXXXXXXXXXXXXXXYLNGSIPSGISKLKNIYQLELYNNNLSGNIPRELGNLTFLKLFDASKNMLSGNIPEEIGNLRNLVSFEAHTNQLTGQIPESIGELQYLEGLSLYNNNLTGQLPQKLGSLSKFNLLDVSENQLNGALPRDMCRGGNLQ
Q19AV8_______________VGEIPETLGNLAELTNLDLSINRLSGSIPESITKLDKVAQIELYQNLLSGPIPVAMGELKALKRFDASMNMLNGSIPAGLGSL-NLESLNLYQNDLVGEIPPGLGSFASLTELKLFSNRLTGRLPESLGRYSDLQALDIADNLLSGSLPPDLCKNKKLE

SNPs (tot: 7)

Position	A %	C %	G %	T %	Probability
269	80			20	0.995493
271	80			20	0.995493
414		87	12		0.992554
473		20		80	0.995493
494	25			75	0.996473
495		25		75	0.996473
497	75			25	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain