|
||||||
|
UniGene Name: sp_v3.0_unigene11257
Length: 226 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene11257
G |
|
Ace file of the UniGene sp_v3.0_unigene11257
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ammonium transporter n=1 Tax=Populus trichocarpa RepID=B9GRB5_POPTR | - | - | 2.0e-22 | 82% |
| FL-Next | sp=Ammonium transporter 1 member 2; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 79% |
| Sma3 | Ammonium transporter | - | - | 8.484e-36 | - |
| Source | Gene names |
|---|---|
| Sma3 | AMT1; AMT1.1; AMT1.2; AMT1.3; AMT1.4; AMT1A; Amt1; At1g64780; At3g24290; At3g24300; At4g13510; At4g28700; CHLREDRAFT_158745; CsAMT1; F13O11.9; F16A16.190; GSVIVT00020387001; GSVIVT00024113001; K7M2.6; MICPUCDRAFT_29536; OJ1234_B11.1; OJ1234_B11.3; OJ1372_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | ammonium transmembrane transporter activity | GO:0008519 | Molecular Function | 0.0 | - |
| Sma3 | high affinity secondary active ammonium transmembrane transporter activity | GO:0015398 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | ammonium transport | GO:0015696 | Biological Process | 0.0 | - |
| Sma3 | methylammonium transport | GO:0015843 | Biological Process | 0.0 | - |
| Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ammonium transporter | IPR001905 | - | 0.0 | - |
| Sma3 | Villin headpiece | IPR003128 | - | 0.0 | - |
| Sma3 | Gelsolin | IPR007122 | - | 0.0 | - |
| Sma3 | Gelsolin domain | IPR007123 | - | 0.0 | - |
| Sma3 | Phosphoesterase | IPR007312 | - | 0.0 | - |
| Sma3 | IPR010256 | - | 0.0 | - | |
| Sma3 | Ammonium transporter, conserved site | IPR018047 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G24290.1 | " AMT1;5 ammonium transporter 1;5 chr3:8801400-8802890 REVERSE LENGTH=496" | 2.0e-26 | 73% |
| RefSeq | Arabidopsis thaliana | NP_189072.1 | putative ammonium transporter 1 member 5 [Arabidopsis thaliana] | 3.0e-26 | 73% |
| RefSeq | Populus trichocarpa | XP_002303104.1 | ammonium transporter [Populus trichocarpa] | 6.0e-29 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O04161
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 416 aas, your sequence is shorter than subject: 75 - 514
Fln protein:
Y
Protein Length:
76
Fln nts:
G
Fln Alignment:
Contig11257___KLQAVSDHLAATGRAVDTTYLLFSAFLVFAMQLGFAMLCAGSVRAKNAVNIMLTNVLDAAAGGIFYY
O04161_______________RFSAVSEYLTNTTYAVDTTYLLFSAYLVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGFSYY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
