SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene10765

Length: 888 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

Ace file of the UniGene sp_v3.0_unigene10765 (antisense)

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Sex determining protein n=3 Tax=Mus musculus musculus RepID=O35861_MOUSE	-	-	5.0e-20	28%
FL-Next	tr=Predicted protein; Physcomitrella patens subsp. patens (Moss).	-	-	0.0	23%
Sma3	Transposon protein, putative, CACTA, En/Spm sub-class, expressed	-	-	4.915e-17	-

Source	Gene names
Sma3	APG; APG1; AT4g22020; At1g05135; At1g20130; At1g62240; At2g05580; At2g32690; At2g36120; At3g17050; At3g17110; At3g20470; At4g01985; At5g40490; At5g46730; B1172G12.21; B1206D04.14; CAI1; CHLREDRAFT_10029; CHLREDRAFT_146684; CHLREDRAFT_195803; CHLREDRAFT_19

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	extracellular space	GO:0005615	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	myosin complex	GO:0016459	Cellular Component	-
Sma3	outer membrane	GO:0019867	Cellular Component	-
Sma3	ribonucleoprotein complex	GO:0030529	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	motor activity	GO:0003774	Molecular Function	-
Sma3	metalloendopeptidase activity	GO:0004222	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	structural constituent of cell wall	GO:0005199	Molecular Function	-
Sma3	ion channel activity	GO:0005216	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	hedgehog receptor activity	GO:0008158	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	lipase activity	GO:0016298	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	histone-lysine N-methyltransferase activity	GO:0018024	Molecular Function	-
Sma3	transition metal ion binding	GO:0046914	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3	ion transport	GO:0006811	Biological Process	-
Sma3	cellular cell wall organization	GO:0007047	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	chromatin modification	GO:0016568	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	High mobility group, HMG-I/HMG-Y	IPR000116	-	-
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	RNA recognition motif domain	IPR000504	-	-
Sma3	Glutamine amidotransferase, class-II	IPR000583	-	-
Sma3	ROK	IPR000600	-	-
Sma3	Sterol-sensing domain	IPR000731	-	-
Sma3	Lipase, GDSL	IPR001087	-	-
Sma3	SET domain	IPR001214	-	-
Sma3	Rhodopsin, archaeal/bacterial/fungal	IPR001425	-	-
Sma3	Bacterial transferase hexapeptide repeat	IPR001451	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Protein phosphatase 2C-like	IPR001932	-	-
Sma3	Thiolase	IPR002155	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	HMW kininogen	IPR002395	-	-
Sma3	Cell surface receptor IPT/TIG	IPR002909	-	-
Sma3	SRA-YDG	IPR003105	-	-
Sma3	Patched	IPR003392	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Repetitive proline-rich cell wall protein repeat	IPR003883	-	-
Sma3	Outer membrane autotransporter barrel	IPR006315	-	-
Sma3	Parallel beta-helix repeat	IPR006626	-	-
Sma3	Pre-SET domain	IPR007728	-	-
Sma3	Lipase, GDSL, active site	IPR008265	-	-
Sma3	Peptidase M11, gametolysin	IPR008752	-	-
Sma3	Procyclic acidic repetitive	IPR008882	-	-
Sma3		IPR010616	-	-
Sma3	Nucleotide-binding, alpha-beta plait	IPR012677	-	-
Sma3	Peptidase M10B, serralysin, C-terminal	IPR013858	-	-
Sma3	Domain of unknown function DUF1929	IPR015202	-	-
Sma3	Galactose oxidase, beta-propeller	IPR015916	-	-
Sma3	Peptidase S1/S6, chymotrypsin/Hap, active site	IPR018114	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	EF-HAND 2	IPR018249	-	-

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: tr_plants

Fln subject: A9SWJ2

Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 295 - 407

Fln protein: ILFISPTDIYAKIA*RSNLTTRFIAMQITS*RKPCKLLSKLRQPSQFSSSLPFSIPHHHQLLHRFHSQNHHLSRFHSHCRNRNQNQTRSLNQRQSRFHSRHHLQSQNHFRSHSHFLNRFHNHRQNQNQNHSQSQNRFRSHYLNQNQTHILNQSQNRFRSHYLNQNQTHILNQSQNRFHSHCHFPNQTRSLIQSQNRFHNHYQSQSHFHNHCQIRSRNHSLNQTQSHFHSHCHRQNHFHNHYQNRSHSQNHFHNHYQSRSHRHNRTPPRRRCRYRYRNLVHNYPPSHPCDRFLMHD

Protein Length: 296

Fln nts: CAATACTGTTTATATCACCCACTGATATATATGCAAAGATTGCATAGCGTTCTAATTTAACTACACGCTTTATTGCGATGCAAATTACATCGTAAAGAAAACCATGCAAGTTATTGAGCAAACTTAGACAGCCTTCTCAGTTTTCGTCTTCACTTCCATTTAGTATCCCCCACCACCACCAGCTCCTCCACCGTTTCCATAGCCAGAACCACCATCTGAGCCGCTTCCATAGCCATTGCCGGAACCGGAACCAGAACCAGACCCGTAGCCTGAACCAGCGCCAGAGCCGCTTCCATAGCCGCCACCACCTCCAGAGCCAGAACCACTTCCGTAGCCACTCCCACTTCCTGAACCGTTTCCATAACCACCGCCAGAACCAGAACCAGAACCATAGCCAGAGCCAGAACCGCTTCCGTAGCCACTACCTGAACCAGAACCAGACCCATATCCTGAACCAGAGCCAGAACCGCTTCCGTAGCCACTACCTGAACCAGAACCAGACCCATATCCTGAACCAGAGCCAGAACCGCTTCCATAGCCACTGCCACTTCCCGAACCAGACCCGTAGCCTGATCCAGAGCCAGAACCGCTTCCATAACCACTACCAGAGCCAGAGCCACTTCCATAACCACTGCCAGATCCGGAGCCGGAACCATAGCCTGAACCAGACCCAGAGCCACTTCCATAGCCACTGCCACCGCCAGAACCACTTCCATAACCACTACCAGAACCGGAGCCACTCCCAGAACCACTTCCATAACCACTACCAGAGCCGGAGCCACCGCCATAACCGGACCCCGCCCCGTCGCCGTTGCCGTTACCGTTACCGTAACCTGGTCCATAACTACCCCCCGAGCCACCCTTGCGACCGCTTCCTAATGCACGACC

Fln Alignment:

Contig10765___HHHQLLHRFHSQNHHLSRFHSHCRNRNQNQTRSLNQRQSRFHSRHHLQSQNHFRS---HSHFLXXXXXXXXXXXXXXXXXXXXXXSHYLNQNQTHILNQSQNRFRSHYLNQNQTHILNQSQNRFHSHCHFPNQTRSLIQSQNRFHNHYQSQSHFHNHCQIRSRNHSL-NQTQSHFHSHCHRQNHFHN-HYQNRSHSQNHFHNH
A9SWJ2_______________HHKE--HGSHSHHHSSHKDHHHSRDRYHHRSYHSPDRHSQHSQERSSGHKHHARSPERHGH------------------------SSHSHHSQGHRHRSSSHK--SHHSRSPDRHHSHGHRHHHHKECSDGHHSSHHSKESRGHHHHYESSEHRGHH---RSRDHSEGSEHRGHHRSPDHKESSEHRGHHRNRDHKEGSEHSH

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
614	25			75	0.996473
628			80	20	0.995493
630			20	80	0.995493
633	20		80		0.995493
634			80	20	0.995493
635			20	80	0.995493
674	80		20		0.995493
748	80	20			0.995493

SSRs (tot: 2)

Start position	End position	Sequence	Length
498	518	TGGTTC TGGTTC TGGTTC TGG	21
708	719	TGG TGG TGG TGG	12

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain