|
||||||
|
UniGene Name: sp_v3.0_unigene9492
Length: 242 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene9492
G |
|
Ace file of the UniGene sp_v3.0_unigene9492
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative chloroplast SRP receptor cpFtsY precursor [Oryza sativa Japonica Group] dbj|BAG86738.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC72197.1| hypothetical protein OsI_05275 [Oryza sativa Indica Group] gb|EEE56037.1| hypothetical pr | - | - | 6.0e-25 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Source | Gene names |
|---|---|
| Sma3 | At2g45770; CHLREDRAFT_105469; FTSY; GSVIVT00026227001; OJ1294_F06.26-1; OJ1294_F06.26-2; OSTLU_4604; Os01g0958100; OsI_05275; OsI_23481; OsJ_04826; Ot07g04260; PHATRDRAFT_14412; PHYPADRAFT_132686; POPTRDRAFT_572201; POPTRDRAFT_587617; RCOM_1614410; THAPSD |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast thylakoid | GO:0009534 | Cellular Component | 0.0 | - |
| Sma3 | signal recognition particle | GO:0048500 | Cellular Component | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | 7S RNA binding | GO:0008312 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | SRP-dependent cotranslational protein targeting to membrane | GO:0006614 | Biological Process | 0.0 | - |
| Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Signal recognition particle, SRP54 subunit, GTPase | IPR000897 | - | 0.0 | - |
| Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Cell division transporter substrate-binding protein FtsY | IPR004390 | - | 0.0 | - |
| Sma3 | Signal recognition particle, SRP54 subunit, helical bundle | IPR013822 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G45770.2 | CPFTSY signal recognition particle receptor protein, chloroplast (FTSY) chr2:18851248-18853402 FORWARD LENGTH=373 | 2.0e-29 | 78% |
| RefSeq | Arabidopsis thaliana | NP_566056.1 | fused signal recognition particle receptor [Arabidopsis thaliana] | 7.0e-32 | 87% |
| RefSeq | Populus trichocarpa | XP_002320775.1 | predicted protein [Populus trichocarpa] | 3.0e-32 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AD34
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 134 aas, your sequence is shorter than subject: 57 - 199
Fln protein:
M
Protein Length:
58
Fln nts:
G
Fln Alignment:
Contig9492___MIVGVNGGGKTTSIGKLAYRLKNEGIKVLMAAGDTFRAAASDQLDVWAKR
D5AD34______________MIVGVNGGGKTTSIGKLAYRLKNEGIKVLMAAGDTFRAAASDQLEVWAKR
| SNPs (tot: 3) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 83 | 11 | 88 | 0.923564 | ||
| 86 | 88 | 11 | 0.923564 | ||
| 154 | 16 | 83 | 0.994512 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
