|
||||||
|
UniGene Name: sp_v3.0_unigene9305
Length: 218 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene9305
A |
|
Ace file of the UniGene sp_v3.0_unigene9305
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dicer-like protein n=1 Tax=Populus trichocarpa RepID=B9HYI3_POPTR | - | - | 3.0e-15 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Dicer-like protein | - | - | 2.962e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g03300; DCL901; DCL903; GSVIVT00025032001; PHYPADRAFT_234670; POPTRDRAFT_765644; POPTRDRAFT_770140; RCOM_1077610; T17B22.1; VITISV_043738; dcl2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
| Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
| Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
| Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
| Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G03300.1 | DCL2, ATDCL2 dicer-like 2 chr3:768020-774833 REVERSE LENGTH=1388 | 3.0e-18 | 65% |
| RefSeq | Arabidopsis thaliana | NP_001078101.1 | protein dicer-like 2 [Arabidopsis thaliana] | 4.0e-18 | 65% |
| RefSeq | Populus trichocarpa | XP_002315119.1 | dicer-like protein [Populus trichocarpa] | 7.0e-20 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW09
Fln msg: Distance to subject end: 193 aas, your sequence is shorter than subject: 72 - 330
Fln protein:
M
Protein Length:
73
Fln nts:
A
Fln Alignment:
Contig9305___MPSTRKLDTGFVYNVNVPYLESLLKYSFRVHTLLVESVTHASYKEPSFSGCYQRLEFLGDAVLDYLITFYFY
A9NW09______________MPFTRKLDTGFVSNVNVRYLESLLKYSFRVHTLVVESVTHASYKEPSFSGCYQRLEFLGDAVLDYLITLYFY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
