UniGene Name: sp_v3.0_unigene4773
Length: 246 nt
![]() |
---|
>sp_v3.0_unigene4773
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | sugar transport protein 14 [Arabidopsis thaliana] ref|NP_001185417.1| sugar transport protein 14 [Arabidopsis thaliana] sp|Q8GW61.2|STP14_ARATH RecName: Full=Sugar transport protein 14; AltName: Full=Hexose transporter 14 gb|AAC34349.1| Putative monosacch | - | - | 1.0e-22 | 72% |
FL-Next | tr=PaMst-1; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 83% |
Sma3 | Sugar transporter, putative | - | - | 4.694e-27 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 5.689e-16 | - |
Source | Gene names |
---|---|
Sma3 | AGAA.1; At1g11260; At1g50310; At1g77210; At3g19930; At3g19940; At4g02050; At4g21480; At5g23270; At5g26340; B1103G11.41; B1317D11.119-1; B1317D11.119-2; F14I3.9; F18E5.100; F9D12.17; GSVIVT00004559001; GSVIVT00005628001; GSVIVT00009747001; GSVIVT0001668900 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
Sma3 | high-affinity hydrogen:glucose symporter activity | GO:0005358 | Molecular Function | 0.0 | - |
Sma3 | sucrose:hydrogen symporter activity | GO:0008506 | Molecular Function | 0.0 | - |
Sma3 | monosaccharide transmembrane transporter activity | GO:0015145 | Molecular Function | 0.0 | - |
Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
Sma3 | sucrose transport | GO:0015770 | Biological Process | 0.0 | - |
Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G77210.1 | STP14, AtSTP14 sugar transporter 14 chr1:29009036-29010980 REVERSE LENGTH=504 | 4.0e-29 | 72% |
RefSeq | Arabidopsis thaliana | NP_001185417.1 | sugar transport protein 14 [Arabidopsis thaliana] | 6.0e-29 | 72% |
RefSeq | Populus trichocarpa | XP_002324436.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: O24245
Fln msg: Distance to subject end: 34 aas, your sequence is shorter than subject: 81 - 513
Fln protein:
V
Protein Length:
82
Fln nts:
C
Fln Alignment:
Contig4773___VCSEIFPMETRSAGQSIVVCVNLFFTAVIAQSFLALLCHLKYGIFLLFGALVCLMSLVIYFFLPETKNVHIEE
O24245______________VCSEIFPME------SLVVCVNLFFTAVIAQSFLALLCHLKYGIFLLFGGLVFIMSVVIYFFLPETKNVPIEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain