SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene4403

Length: 466 nt

UniGene Fasta

>sp_v3.0_unigene4403
AGTGTATAGTTGGTGTTTGACTATCTTCTATTTTATACTAGTAAAAGAGATGCAGGTTTTGAGTGATAGAAATAAGAGTTCGCTGAGAGACTAGAGACATTATCGAATATACAGAAAATTGCTTGTTGGATGCACACTGGGGAGAGGCAGGTGGGTAAATTGAGAGAGAAATACTTAGAAGCAGTGCTGAAGCAGGATGTGGGATTCTTTGACACGGATGCTATGACCGGGGATATAGTTTTCAGCATTTCCACAGATACTCTTCTCGTTCAAGATGCAATCAGTGAAAAGGTGGGAAATTTTATACACTACCTATCAACATTCTTGGCAGGTTTGGTGGTTGGATTTGTTTCAGCATGGAGATTAGCTATCCTGAGTGTTGCCGTTATACCAGGCATTGCATTTGCTGGAGGTTTATATGCTCATACGATCACAGGATTGACATCTAAGAGCCAAGAAGCTTATG

Ace file of the UniGene sp_v3.0_unigene4403

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Multidrug/pheromone exporter, MDR family, ABC transporter family n=5 Tax=core eudicotyledons RepID=B9IJV9_POPTR	-	-	0.0	87%
FL-Next	tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew).	-	-	0.0	42%
Sma3	Multidrug/pheromone exporter, MDR family, ABC transporter family	-	-	1.358e-18	-

Source	ECs	Term	Type	e value	Identity
Sma3	Xenobiotic-transporting ATPase.	EC:3.6.3.44	-	3.732e-09	-

Source	Gene names
Sma3	At1g10680; At1g27940; At1g28010; At2g36910; At3g28860; At4g25960; CMDR1; Cjmdr1; F13K9.11; F13K9.5; F20B24.12; GSVIVT00000633001; GSVIVT00014386001; GSVIVT00015725001; GSVIVT00020929001; H0423H10.7; MDR1; MDR10; MDR11; MDR12; MDR15; MDR2; MLD15.2; OJ1148_

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	auxin efflux transmembrane transporter activity	GO:0010329	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of substances	GO:0042626	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	regulation of cell size	GO:0008361	Biological Process	-
Sma3	response to nematode	GO:0009624	Biological Process	-
Sma3	response to blue light	GO:0009637	Biological Process	-
Sma3	photomorphogenesis	GO:0009640	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	auxin polar transport	GO:0009926	Biological Process	-
Sma3	positive gravitropism	GO:0009958	Biological Process	-
Sma3	response to far red light	GO:0010218	Biological Process	-
Sma3	basipetal auxin transport	GO:0010540	Biological Process	-
Sma3	acropetal auxin transport	GO:0010541	Biological Process	-
Sma3	anthocyanin accumulation in tissues in response to UV light	GO:0043481	Biological Process	-
Sma3	stamen development	GO:0048443	Biological Process	-
Sma3	lateral root development	GO:0048527	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K Homology domain, type 1	IPR004088	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT3G28860.1	ATMDR1, ATMDR11, PGP19, MDR11, MDR1, ATPGP19, ABCB19, ATABCB19 ATP binding cassette subfamily B19 chr3:10870287-10877286 REVERSE LENGTH=1252	85%
RefSeq	Arabidopsis thaliana	NP_189528.1	ABC transporter B family member 19 [Arabidopsis thaliana]	85%
RefSeq	Populus trichocarpa	XP_002323847.1	multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa]	87%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: E6Y0T0

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 1073 aas, your sequence is shorter than subject: 155 - 1316

Fln protein: SV*LVFDYLLFYTSKRDAGFE**K*EFAERLETLSNIQKIACWMHTGERQVGKLREKYLEAVLKQDVGFFDTDAMTGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLAILSVAVIPGIAFAGGLYAHTITGLTSKSQEAY

Protein Length: 156

Fln nts: AGTGTATAGTTGGTGTTTGACTATCTTCTATTTTATACTAGTAAAAGAGATGCAGGTTTTGAGTGATAGAAATAAGAGTTCGCTGAGAGACTAGAGACATTATCGAATATACAGAAAATTGCTTGTTGGATGCACACTGGGGAGAGGCAGGTGGGTAAATTGAGAGAGAAATACTTAGAAGCAGTGCTGAAGCAGGATGTGGGATTCTTTGACACGGATGCTATGACCGGGGATATAGTTTTCAGCATTTCCACAGATACTCTTCTCGTTCAAGATGCAATCAGTGAAAAGGTGGGAAATTTTATACACTACCTATCAACATTCTTGGCAGGTTTGGTGGTTGGATTTGTTTCAGCATGGAGATTAGCTATCCTGAGTGTTGCCGTTATACCAGGCATTGCATTTGCTGGAGGTTTATATGCTCATACGATCACAGGATTGACATCTAAGAGCCAAGAAGCTTATG

Fln Alignment:

Contig4403___LSNIQKIACWMHTGERQVGKLREKYLEAVLKQDVGFFDTDAMTGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLAILSVAVIPGIAFAGGLYAHTITGLTSKSQEAY
E6Y0T0______________VASLLQVSCWMCTGERQATRIRSLYLKTILRQDIGFFDSEASTGEVIGRMSGDTILIQDAMGEKVGKFIQFITTFIAGFVIAFIKGWKLSLVMLSMIPLLVVSGGSMAMIISKMSSRGQQAY

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain