SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene4671

Length: 277 nt

UniGene Fasta

>sp_v3.0_unigene4671
AATGTATGGTCTACTTTATCCGGATAGTGTTGTTGGAACTGATTCCCACACAACTATGATAGATGGATTAGGTGTTGCTGGCTGGGGAGTTGGAGGAATCGAAGCAGAAGCTGCTATGCTTGGCCAGCCAATGAGTATGGTTCTTCCTGGTGTTGTTGGTTTCAAATTAACTGGCACTTTGTATACGTGGGATCCAAAATCCACTTACATACATGATCCTCCATATTTTAAAGATATGACAATGACTCCTCCTGGTCCACATGGCGTGAAGGATGCA

Ace file of the UniGene sp_v3.0_unigene4671

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Aconitate hydratase (Fragment) n=8 Tax=Pinaceae RepID=E3V1P1_PINSY	-	-	1.0e-15	76%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	76%
Sma3	Putative aconitase	-	-	1.976e-14	-

Source	ECs	Term	Type	e value	Identity
Sma3	Aconitate hydratase.	EC:4.2.1.3	-	7.408e-33	-

Source	KEGGs	Term	e value	Identity
Sma3	Citrate cycle (TCA cycle)	00020	7.408e-33	%
Sma3	Glyoxylate and dicarboxylate metabolism	00630	7.408e-33	%
Sma3	Carbon fixation pathways in prokaryotes	00720	7.408e-33	%
Sma3	Biosynthesis of phenylpropanoids	01061	7.408e-33	%
Sma3	Biosynthesis of terpenoids and steroids	01062	7.408e-33	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	7.408e-33	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	7.408e-33	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	7.408e-33	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	7.408e-33	%
Sma3	Biosynthesis of plant hormones	01070	7.408e-33	%
Sma3	Metabolic pathways	01100	7.408e-33	%
Sma3	Biosynthesis of secondary metabolites	01110	7.408e-33	%

Source	Gene names
Sma3	ACO; ACO1; ACO2; ACO3; At2g05710; At4g26970; At4g35830; B1435D02.25; F10M23.310; F4B14.100; GSVIVT00012354001; GSVIVT00013720001; GSVIVT00026023001; GSVIVT00027318001; IRP1; LOC_Os03g04410; LOC_Os08g09200; Os03g0136900; Os06g0303400; Os08g0191100; OsI_099

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	aconitate hydratase activity	GO:0003994	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	4 iron, 4 sulfur cluster binding	GO:0051539	Molecular Function	-
Sma3	glyoxylate cycle	GO:0006097	Biological Process	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Aconitase A/isopropylmalate dehydratase small subunit, swivel	IPR000573	-	-
Sma3	Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha	IPR001030	-	-
Sma3	Aconitase/iron regulatory protein 2	IPR006249	-	-
Sma3	Aconitase/3-isopropylmalate dehydratase, swivel	IPR015928	-	-
Sma3	Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3	IPR015931	-	-
Sma3	Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2	IPR015932	-	-
Sma3	Aconitase/Iron regulatory protein 2/2-methylisocitrate dehydratase	IPR015934	-	-
Sma3	Aconitase/isopropylmalate dehydratase	IPR015937	-	-
Sma3	Aconitase family, 4Fe-4S cluster binding site	IPR018136	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G35830.1	ACO1 aconitase 1 chr4:16973007-16977949 REVERSE LENGTH=898	3.0e-17	96%
RefSeq	Arabidopsis thaliana	NP_001119125.1	aconitate hydratase 1 [Arabidopsis thaliana]	4.0e-17	96%
RefSeq	Populus trichocarpa	XP_002331755.1	predicted protein [Populus trichocarpa]	3.0e-17	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NX49

Fln msg: Distance to subject end: 231 aas, your sequence is shorter than subject: 92 - 565

Fln protein: MYGLLYPDSVVGTDSHTTMIDGLGVAGWGVGGIEAEAAMLGQPMSMVLPGVVGFKLTGTLYTWDPKSTYIHDPPYFKDMTMTPPGPHGVKDA

Protein Length: 93

Fln nts: AATGTATGGTCTACTTTATCCGGATAGTGTTGTTGGAACTGATTCCCACACAACTATGATAGATGGATTAGGTGTTGCTGGCTGGGGAGTTGGAGGAATCGAAGCAGAAGCTGCTATGCTTGGCCAGCCAATGAGTATGGTTCTTCCTGGTGTTGTTGGTTTCAAATTAACTGGCACTTTGTATACGTGGGATCCAAAATCCACTTACATACATGATCCTCCATATTTTAAAGATATGACAATGACTCCTCCTGGTCCACATGGCGTGAAGGATGCA

Fln Alignment:

Contig4671___GQPMSMVLPGVVGFKLTGTLYTWDPKSTYIHDPPYFKDMTMTPPGPHGVKDA
A9NX49______________GNPMWNQLPVP-----TGTLYTWDPTSTYIHDPPYFKDMTMTPPGPHGVKDA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain