SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene25768

Length: 314 nt

Origin of reads: Biogeco1 v2 Biogeco3 v1

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v2.0_unigene25768
GGAAAAAGTGTTGCCATTGTTGGAACTAGTGGTAGCGGAAAATCTACTATACTTAGGCTTTTGTATCGGTTTTATGATGCTCAATCAGGATCAGTAAGGATAGATGGCCAAGATATAAGAGATGTGACGCTCCATAGTCTGAGAAAGTCCCTTGCTGTAGTTCCTCAGGATACTGTACTTTTCAATGATACAATATTCCATAACATACATTATGGCCGATTGACAGCAACCGAAGAGGAGGTATATGATGCTGCTCGTCATGCAGCAATACATGATACAATTTTACGGTTTCCTGAGCAATACCAAACTCGTGT

Ace file of the UniGene sp_v2.0_unigene25768 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Transporter ATM1, mitochondrial, putative n=1 Tax=Ricinus communis RepID=B9T3V9_RICCO	-	-	7.00649e-45	83%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	58%
Blast2go	abc transporter family of the mitochondria family	-	-	0.0	90%

Source	ECs	Term	Type	e value	Identity
Blast2go	Adenosinetriphosphatase.	EC:3.6.1.3	-	0.0	90%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Purine metabolism	00230		0.0	90%

Source	GOs	Term	Type	Identity
Blast2go	root development	GO:0048364	Biological Process	90%
Blast2go	Mo-molybdopterin cofactor biosynthetic process	GO:0006777	Biological Process	90%
Blast2go	positive regulation of catalytic activity	GO:0043085	Biological Process	90%
Blast2go	cellular iron ion homeostasis	GO:0006879	Biological Process	90%
Blast2go	positive regulation of programmed cell death	GO:0043068	Biological Process	90%
Blast2go	pollen development	GO:0009555	Biological Process	90%
Blast2go	chloroplast organization	GO:0009658	Biological Process	90%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	90%
Blast2go	response to cold	GO:0009409	Biological Process	90%
Blast2go	response to lead ion	GO:0010288	Biological Process	90%
Blast2go	positive regulation of transcription, DNA-dependent	GO:0045893	Biological Process	90%
Blast2go	regulation of multicellular organism growth	GO:0040014	Biological Process	90%
Blast2go	positive regulation of abscisic acid mediated signaling pathway	GO:0009789	Biological Process	90%
Blast2go	response to oxidative stress	GO:0006979	Biological Process	90%
Blast2go	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	90%
Blast2go	enzyme activator activity	GO:0008047	Molecular Function	90%
Blast2go	transporter activity	GO:0005215	Molecular Function	90%
Blast2go	ATPase activity	GO:0016887	Molecular Function	90%
Blast2go	binding	GO:0005488	Molecular Function	90%
Blast2go	chloroplast envelope	GO:0009941	Cellular Component	90%
Blast2go	apoplast	GO:0048046	Cellular Component	90%
Blast2go	stromule	GO:0010319	Cellular Component	90%
Blast2go	phragmoplast	GO:0009524	Cellular Component	90%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	90%
Blast2go	chloroplast thylakoid	GO:0009534	Cellular Component	90%
Blast2go	cell plate	GO:0009504	Cellular Component	90%
Blast2go	plasma membrane	GO:0005886	Cellular Component	90%
Blast2go	mitochondrion	GO:0005739	Cellular Component	90%

Source	InterPros	Term	Type	Identity
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Transcription factor, MADS-box	IPR002100	-	-
Sma3	Carbohydrate/puine kinase, PfkB, conserved site	IPR002173	-	-
Sma3	Ribosomal protein L10, eubacterial, conserved site	IPR002363	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Vacuolar fusion protein MON1	IPR004353	-	-
Sma3	ABC transporter, lipid A export, MsbA	IPR011917	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NW03

Fln msg: Distance to subject end: 51 aas, your sequence is shorter than subject: 104 - 636

Fln protein: GKSVAIVGTSGSGKSTILRLLYRFYDAQSGSVRIDGQDIRDVTLHSLRKSLAVVPQDTVLFNDTIFHNIHYGRLTATEEEVYDAARHAAIHDTILRFPEQYQTR

Protein Length: 105

Fln nts: GGAAAAAGTGTTGCCATTGTTGGAACTAGTGGTAGCGGAAAATCTACTATACTTAGGCTTTTGTATCGGTTTTATGATGCTCAATCAGGATCAGTAAGGATAGATGGCCAAGATATAAGAGATGTGACGCTCCATAGTCTGAGAAAGTCCCTTGCTGTAGTTCCTCAGGATACTGTACTTTTCAATGATACAATATTCCATAACATACATTATGGCCGATTGACAGCAACCGAAGAGGAGGTATATGATGCTGCTCGTCATGCAGCAATACATGATACAATTTTACGGTTTCCTGAGCAATACCAAACTCGTGT

Fln Alignment:

Contig25768___GKSVAIVGTSGSGKSTILRLLYRFYDAQSGSVRIDGQDIRDVTLHSLRKSLAVVPQDTVLFNDTIFHNIHYGRLTATEEEVYDAARHAAIHDTILRFPEQYQT
A9NW03_______________GESIAIVGPSGSGKSTIVKLILRLYDPSNGTLSMDGHDICSIRKDSLRKAVAVVPQDTVLFNDTIFHNILYGLPTASEADVTRAARQAHLHEAVLQMPKGYMT

SNPs (tot: 1)

Position	A %	C %	G %	T %	Probability
108	25			75	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain