SustainPineDB

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene24780

Length: 751 nt

Origin of reads: Inia v1 Biogeco1 v2 Uagpf v2

UniGene Fasta

Ace file of the UniGene sp_v2.0_unigene24780

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Ubiquitin family protein n=3 Tax=Tetrahymena thermophila RepID=UPI00006CC966	-	-	84%
FL-Next	tr=Putative polyubiquitin; Picea abies (Norway spruce) (Picea excelsa).	-	-	100%
Blast2go	ubiquitin family protein	-	-	97%

Source	GOs	Term	Type	Identity
Blast2go	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	GO:0051436	Biological Process	97%
Blast2go	MyD88-independent toll-like receptor signaling pathway	GO:0002756	Biological Process	97%
Blast2go	regulation of signal transduction	GO:0009966	Biological Process	97%
Blast2go	transmembrane receptor protein tyrosine kinase signaling pathway	GO:0007169	Biological Process	97%
Blast2go	anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process	GO:0031145	Biological Process	97%
Blast2go	induction of apoptosis by extracellular signals	GO:0008624	Biological Process	97%
Blast2go	anti-apoptosis	GO:0006916	Biological Process	97%
Blast2go	MyD88-dependent toll-like receptor signaling pathway	GO:0002755	Biological Process	97%
Blast2go	RNA metabolic process	GO:0016070	Biological Process	97%
Blast2go	interphase of mitotic cell cycle	GO:0051329	Biological Process	97%
Blast2go	positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	GO:0051437	Biological Process	97%
Blast2go	cellular membrane organization	GO:0016044	Biological Process	97%
Blast2go	cellular response to stress	GO:0033554	Biological Process	97%
Blast2go	MAPK cascade	GO:0000165	Biological Process	97%
Blast2go	protein binding	GO:0005515	Molecular Function	97%
Blast2go	cytosol	GO:0005829	Cellular Component	97%
Blast2go	nucleoplasm	GO:0005654	Cellular Component	97%
Blast2go	endosome membrane	GO:0010008	Cellular Component	97%

Source	InterPros	Term	Type	Identity
Sma3	Ubiquitin	IPR000626	-	-
Sma3	Ribosomal protein L40e	IPR001975	-	-
Sma3	Ribosomal protein S27a	IPR002906	-	-
Sma3	Isocitrate lyase/phosphorylmutase, conserved site	IPR018523	-	-

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: Q7FPA4

Fln msg: warning!, putative chimeric sequence! or repetitive structure and possible frame ERROR between 695 and 701, Distance to subject end: 168 aas, atg_distance in limit (1-15): atg_distance = 1, W2: There is no M at the beginning,

Fln protein: RRDLGCGYTCLRSPLLAKRSQSASFTGPFH*LYTSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLLGKTIxxxxxxxxxxxxxxxxxxxxxxIPPDQQRLIFAGKQLEDGRTLADYNIQKESTVHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRxxxFAGKQLEDGRTLADYNI

Protein Length: 252

Fln nts: CGTCGTGACCTTGGCTGTGGCTATACTTGCTTGCGTTCTCCTCTCTTAGCGAAACGGTCACAGAGCGCTTCGTTCACAGGTCCTTTTCATTAGCTTTATACCTCTTTCAAG_-_ATGCAGATCTTCGTTAAAACTCTCACTGGTAAGACGATCACCCTCGAGGTTGAAAGTTCTGACACTATTGACAATGTAAAGGCCAAGATTCAGGACAAGGAAGGCATTCCACCCGATCAACAGCGTCTGATCTTTGCCGGAAAGCAGCTAGAAGACGGCCGAACCCTAGCCGACTACAATATCCAGAAGGAATCTACCCTGCATCTCGTGCTTCGTCTGAGAGGTGGCATGCAGATCTTTGTCAAAACCCTCCTTGGCAAGACGATAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxATTCCACCTGACCAGCAGCGTCTGATCTTTGCTGGAAAGCAGCTCGAAGATGGTCGAACACTTGCCGACTACAATATTCAGAAGGAATCCACCGTGCACCTTGTGCTCCGTCTGAGAGGTGGCATGCAGATCTTTGTTAAAACTCTAACCGGCAAGACGATCACCTTGGAAGTTGAGAGCTCTGATACTATTGATAATGTTAAGGCGAAGATCCAGGATAAGGAAGGCATCCCTCCAGACCAACAGAGGCxxxxxxCGTTCGCTGGTAAGCAGCTGGAGGACGGTCGGACCTTGGCAGATTACAACATT

Fln Alignment:

Contig24780___xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFAGKQLEDGRTLADYNI
Q7FPA4_______________xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFAGKQLEDGRTLADYNI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain