SustainPineDB

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene24304

Length: 832 nt

Origin of reads: Biogeco1 v2 Biogeco2 v2 Uma v2

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

Ace file of the UniGene sp_v2.0_unigene24304 (antisense)

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative truncated TIR-NBS-LRR protein n=1 Tax=Pinus monticola RepID=E9NZS7_PINMO	-	-	5.0e-40	49%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	45%
Blast2go	nbs lrr	-	-	1.4013e-45	56%

Source	GOs	Term	Type	e value	Identity
Blast2go	defense response	GO:0006952	Biological Process	1.4013e-45	56%

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PQE2

Fln msg: Separated hits, possible frame ERROR between 216 and 438, and overlapping frame ERROR between 797 and 438, Distance to subject end: 68 aas, your sequence is shorter than subject: 278 - 1071

Fln protein: DVIHMHDHLRDLGSEIAETEFPRRLWRPTGNINYWLHQQSSVIMEARGIRMLPQGDSIERLELCISLSNCFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVYFNASFCANL

Protein Length: 279

Fln nts: GATGTTATACATATGCATGATCACCTCCGTGATTTGGGCAGtGAAATTGCAGAGACTGAATTCCCGCGCCGTCTTTGGCGTCCCACCGGGAACATTAATTATTGGCTGCACCAGCAATCATCTGTTATAATGGAAGCACGCGGAATCAGAATGCTTCCTCAAGGGGATAGTATCGAACGATTGGAGCTTTGCATTAGTCTGTCCAATTGTTTTCTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGTATATTTTAATGCTTCTTTTTGTGCTAATTTAAC

Fln Alignment:

Contig24304___IHMHDHLRDLGSEIAE-TEFPRRLWRPTGNINYWLHQQSSVIMEARGIRMLPQGDSIERLELCISLSNCFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
C0PQE2_______________LRMHDHLRDLGRDLAENSEYPRRIWRMTDSLLHNVSDQSPV----RGISMVHRNGS----ERSCNLSNCKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SNPs (tot: 18)

Position	A %	C %	G %	T %	Probability
444		40		60	1.0
446		40		60	1.0
488			50	50	1.0
516	62		37		1.0
527		85		14	0.993533
529		42		57	1.0
545		57		42	1.0
554	57	42			1.0
560		57	42		1.0
567	14		85		0.993533
574	14	71			0.984337
577		14		85	0.993533
578		14		85	0.993533
581			85	14	0.993533
587	80	20			0.995493
588	80	20			0.995493
591	80			20	0.995493
616		25		75	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain