SustainPineDB

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene18247

Length: 954 nt

Origin of reads: Inia v1 Uagpf v2 Uma v2

UniGene Fasta

Ace file of the UniGene sp_v2.0_unigene18247

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Putative multidrug resistance protein n=8 Tax=Poaceae RepID=MDR_ORYSJ	-	-	56%
FL-Next	tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew).	-	-	45%
Blast2go	abc transporter b family member	-	-	82%

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Ribosomal protein L10, eubacterial, conserved site	IPR002363	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K Homology domain, type 1	IPR004088	-	-
Sma3	Vacuolar fusion protein MON1	IPR004353	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3		IPR013596	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: E6Y0T0

Fln msg: ERROR#3, very serious frame error, warning!, putative chimeric sequence! or repetitive structure Unexpected STOP codon at 3' end. Distance to subject end: 57 aas, your sequence is shorter than subject: 217 - 1316

Fln protein: GAAWR*LEEWIVVSFPLSSD**RRFYDPLKGTVLVDGKDIRSFNLRSLxxxxxxxRLAVTLFAGSIRENIAYGKENASEAEIIDAAKAANAHEFISCLKDGYETSTGNRGTQLSGGQKQRIAIARAIIKNPSILLLDEATSALDAYSEKVVQEALDRVTVGTTTVTVAHRLASVQNADCIAVIEKGSVVEQGNHLHLMDKGEGGAYFGLIKLQQRQ*

Protein Length: 218

Fln nts: GGAGCAGCGTGGCGCTAGTTGGAAGAGTGGATCGTGGTAAGTTTTCCACTATCATCGGATTGATAGAGAAGATTCTATGATCCGCTGAAAGGGACAGTACTCGTTGATGGGAAAGATATAAGGAGCTTCAATTTGCGGTCATTGxxxxxxxxxxxxxxxxxxxxxAGGTTGGCTGTCACTCTTTTTGCTGGGAGCATCCGGGAGAACATTGCCTATGGTAAAGAGAACGCAAGTGAGGCGGAAATAATAGATGCTGCCAAGGCTGCCAATGCCCATGAATTCATTTCGTGCTTGAAGGATGGATACGAAACGAGCACAGGGAACCGCGGAACGCAGCTGTCTGGGGGCCAGAAGCAAAGGATAGCGATAGCAAGGGCAATTATTAAGAATCCAAGCATCTTGCTGTTGGACGAGGCAACCAGTGCATTGGATGCTTATTCGGAGAAGGTAGTTCAGGAGGCATTGGATCGAGTGACCGTCGGAACAACGACTGTCACTGTAGCTCATCGACTGGCGTCAGTTCAAAATGCTGACTGTATAGCGGTTATTGAAAAGGGAAGCGTTGTTGAGCAGGGAAATCACTTGCATCTCATGGACAAAGGCGAAGGCGGTGCATATTTTGGTCTTATCAAACTGCAGCAGCGTCAGTAGGCAATTTTTGTATTCAAATTGTGTGGGGCAACCAGTTGTAAGTAATTCAAAAAAGGTTGGCAAAAGGATCGCCATAGGTCACAATTGTATCCATAGTTCCGAATACCCGAAGTTTTCAGGCGTCATAACTGTCACATTGACAACCATAGCGTTCACTGTACCAAGAATTATTAACTTAATAACGGAATAAATGAATTCCGATTATTATTACTTATTTGATCAATACCTGCCATTGTTCCAAAAGGCCCAAAGAGATTCTGTTAGGATTTTTAAATTGGAAAAGCTATACTTTAATTTTCTTAACC

Fln Alignment:

Contig18247___xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
E6Y0T0_______________xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SNPs (tot: 51)

Position	A %	C %	G %	T %	Probability
307			66	33	0.997452
309	66		33		0.997452
310			33	66	0.997452
389	75	25			0.996473
390			25	75	0.996473
392	75	25			0.996473
393			25	75	0.996473
395	75		25		0.996473
397		25	75		0.996473
398	75	25			0.996473
399	75			25	0.996473
401		75	25		0.996473
403	75			25	0.996473
404	75		25		0.996473
405			75	25	0.996473
410		25		75	0.996473
423	80			20	0.995493
424		20	80		0.995493
426		80		20	0.995493
427	80		20		0.995493
432			80	20	0.995493
435		80	20		0.995493
436	80	20			0.995493
438			20	80	0.995493
439			80	20	0.995493
440		20	80		0.995493
442		20		80	0.995493
443			80	20	0.995493
445	20			80	0.995493
487		77	22		1.0
490		77	4		1.0
492			22	77	1.0
497	22	77			1.0
498	22			77	1.0
499		22		77	1.0
501	22		77		1.0
537	90			9	0.999842
569	77		22		1.0
571	12		83		1.0
659	8		91		0.999766
683	9		90		0.999842
696		81	18		1.0
755	21	78			1.0
763		78	21		1.0
769		78	21		1.0
808		80		20	1.0
863			78	21	1.0
874		81		18	0.999994
876			20	80	0.999996
894	14	85			0.993533
941	33		66		0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain