UniGene Name: sp_v2.0_unigene12386
Length: 230 nt
Origin of reads:
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v2.0_unigene12386
C |
Ace file of the UniGene sp_v2.0_unigene12386 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative gamma-glutamyltransferase [Arabidopsis thaliana] emb|CAB80628.1| putative gamma-glutamyltransferase [Arabidopsis thaliana] gb|AAT06480.1| At4g39650 [Arabidopsis thaliana] | - | - | 3.0e-18 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Selaginella moellendorffii (Spikemoss). | - | - | 0.0 | 73% |
| Blast2go | gamma-glutamyltranspeptidase 1-like | - | - | 1.53662e-25 | 79% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine--glyoxylate transaminase. | EC:2.6.1.44 | - | 1.53662e-25 | 79% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 1.53662e-25 | 79% | |
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 1.53662e-25 | 79% | |
| Blast2go | Metabolic pathways | 01100 | 1.53662e-25 | 79% | |
| Blast2go | Gamma-glutamyltransferase. | EC:2.3.2.2 | - | 1.53662e-25 | 79% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cyanoamino acid metabolism | 00460 | 1.53662e-25 | 79% | |
| Blast2go | Glutathione metabolism | 00480 | 1.53662e-25 | 79% | |
| Blast2go | Arachidonic acid metabolism | 00590 | 1.53662e-25 | 79% | |
| Blast2go | Metabolic pathways | 01100 | 1.53662e-25 | 79% | |
| Blast2go | Alanine transaminase. | EC:2.6.1.2 | - | 1.53662e-25 | 79% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 1.53662e-25 | 79% | |
| Blast2go | Carbon fixation in photosynthetic organisms | 00710 | 1.53662e-25 | 79% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.53662e-25 | 79% | |
| Blast2go | Metabolic pathways | 01100 | 1.53662e-25 | 79% | |
| Blast2go | Glutathione gamma-glutamylcysteinyltransferase. | EC:2.3.2.15 | - | 1.53662e-25 | 79% |
| Blast2go | Glycine transaminase. | EC:2.6.1.4 | - | 1.53662e-25 | 79% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 1.53662e-25 | 79% | |
| Blast2go | Metabolic pathways | 01100 | 1.53662e-25 | 79% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | glutathione transmembrane transport | GO:0034775 | Biological Process | 1.53662e-25 | 79% |
| Blast2go | glutathione catabolic process | GO:0006751 | Biological Process | 1.53662e-25 | 79% |
| Blast2go | photorespiration | GO:0009853 | Biological Process | 1.53662e-25 | 79% |
| Blast2go | GO:0008415 | Molecular Function | 1.53662e-25 | 79% | |
| Blast2go | alanine-glyoxylate transaminase activity | GO:0008453 | Molecular Function | 1.53662e-25 | 79% |
| Blast2go | gamma-glutamyltransferase activity | GO:0003840 | Molecular Function | 1.53662e-25 | 79% |
| Blast2go | L-alanine:2-oxoglutarate aminotransferase activity | GO:0004021 | Molecular Function | 1.53662e-25 | 79% |
| Blast2go | glutathione gamma-glutamylcysteinyltransferase activity | GO:0016756 | Molecular Function | 1.53662e-25 | 79% |
| Blast2go | glycine:2-oxoglutarate aminotransferase activity | GO:0047958 | Molecular Function | 1.53662e-25 | 79% |
| Blast2go | peroxisome | GO:0005777 | Cellular Component | 1.53662e-25 | 79% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 1.53662e-25 | 79% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 1.53662e-25 | 79% |
| Blast2go | apoplast | GO:0048046 | Cellular Component | 1.53662e-25 | 79% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Gamma-glutamyltranspeptidase | IPR000101 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D8QVY2
Fln msg: Distance to subject end: 433 aas, your sequence is shorter than subject: 76 - 627
Fln protein:
T
Protein Length:
77
Fln nts:
C
Fln Alignment:
Contig12386___SSGLGGGAFMLLRSSNGQAQAFNMRETAPQAASEDMYAKNPAAKKIGSLSIGVPGELAGLHLAWQQHG
D8QVY2_______________SSGIGGGAFLLLRLANGSAIAYDMRETAPAAASKDMYAKNPSSKVDGALSAGVPGELAGLHLAWQHFG
SNPs (tot: 4) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 70 | 66 | 33 | 0.997452 | ||
| 112 | 25 | 75 | 0.996473 | ||
| 149 | 25 | 75 | 0.996473 | ||
| 231 | 25 | 75 | 0.996473 |

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)