SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene12085

Length: 361 nt

Origin of reads: Biogeco1 v2 Biogeco3 v1

UniGene Fasta

>sp_v2.0_unigene12085
AGAACGCAACCTGCTGGAGATTACCGATGGAATCAGAAACAGTTAATGGCGGATCTTGCAGGCCTCTGCACGTTGTTGCAGTTCCACTTCCAGTTCAGGGGCATATGACTCCCATGTTTAATTTCTCGAAGAAGCTAGCAGCGAAGGGTGTTATTGTCACGTTTGTTACTACGGAAGCTTGTTATGCGAACATCATTAAAGCCCATAACGGGGAGGACCCCTTCTCCCACGACCGGAGCTTGGGTTTAGATATCCGCTCCCTTCAGGTTAGTGATGGATTGCCCCTGGAAGCTGATAGATCGTTGAATTTGGAGTTTATAGAATCATTCCAGACTAATATGATGCCGCATGTTGAAGAGCT

Ace file of the UniGene sp_v2.0_unigene12085

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glucosyltransferase n=1 Tax=Dianthus caryophyllus RepID=A7M6J0_DIACA	-	-	2.0e-12	41%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	83%
Blast2go	udp-glycosyltransferase-like protein	-	-	0.0	61%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	0.0	61%

Source	KEGGs	Term	Identity
Blast2go	Fructose and mannose metabolism	00051	61%
Blast2go	N-Glycan biosynthesis	00510	61%
Blast2go	Mucin type O-Glycan biosynthesis	00512	61%
Blast2go	Various types of N-glycan biosynthesis	00513	61%
Blast2go	Other types of O-glycan biosynthesis	00514	61%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	61%
Blast2go	Glycosaminoglycan biosynthesis - keratan sulfate	00533	61%
Blast2go	Lipopolysaccharide biosynthesis	00540	61%
Blast2go	Peptidoglycan biosynthesis	00550	61%
Blast2go	Glycerolipid metabolism	00561	61%
Blast2go	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563	61%
Blast2go	Sphingolipid metabolism	00600	61%
Blast2go	Glycosphingolipid biosynthesis - lacto and neolacto series	00601	61%
Blast2go	Glycosphingolipid biosynthesis - globo series	00603	61%
Blast2go	Glycosphingolipid biosynthesis - ganglio series	00604	61%
Blast2go	Carotenoid biosynthesis	00906	61%
Blast2go	Zeatin biosynthesis	00908	61%
Blast2go	Flavonoid biosynthesis	00941	61%
Blast2go	Anthocyanin biosynthesis	00942	61%
Blast2go	Flavone and flavonol biosynthesis	00944	61%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	61%
Blast2go	Betalain biosynthesis	00965	61%
Blast2go	Biosynthesis of type II polyketide products	01057	61%
Blast2go	Metabolic pathways	01100	61%
Blast2go	Biosynthesis of secondary metabolites	01110	61%

Source	GOs	Term	Type	e value	Identity
Blast2go	metabolic process	GO:0008152	Biological Process	0.0	61%
Blast2go	transferase activity, transferring hexosyl groups	GO:0016758	Molecular Function	0.0	61%

Source	InterPros	Term	Type	e value	Identity
Sma3	UDP-glucuronosyl/UDP-glucosyltransferase	IPR002213	-	0.0	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LNU7

Fln msg: Distance to subject end: 378 aas, your sequence is shorter than subject: 111 - 491

Fln protein: MESETVNGGSCRPLHVVAVPLPVQGHMTPMFNFSKKLAAKGVIVTFVTTEACYANIIKAHNGEDPFSHDRSLGLDIRSLQVSDGLPLEADRSLNLEFIESFQTNMMPHVEE

Protein Length: 112

Fln nts: AGAACGCAACCTGCTGGAGATTACCG_-_ATGGAATCAGAAACAGTTAATGGCGGATCTTGCAGGCCTCTGCACGTTGTTGCAGTTCCACTTCCAGTTCAGGGGCATATGACTCCCATGTTTAATTTCTCGAAGAAGCTAGCAGCGAAGGGTGTTATTGTCACGTTTGTTACTACGGAAGCTTGTTATGCGAACATCATTAAAGCCCATAACGGGGAGGACCCCTTCTCCCACGACCGGAGCTTGGGTTTAGATATCCGCTCCCTTCAGGTTAGTGATGGATTGCCCCTGGAAGCTGATAGATCGTTGAATTTGGAGTTTATAGAATCATTCCAGACTAATATGATGCCGCATGTTGAAGAGCT

Fln Alignment:

Contig12085___MESETVNGGSCRPLHVVAVPLPVQGHMTPMFNFSKKLAAKGVIVTFVTTEACYANIIKAHNGEDPFSHDRSLGLDIRSLQVSDGLPLEADRSLNL-EFIESFQTNMMPHVEE
B8LNU7_______________MESKTINGLSCRPLHVVAVPLPVQGHITPMFNFAKKLAAKGVTVTFVNTEACYANITKARNGEDPFSHAQSLGLDIRSAQISDGLPLEFDRSLNAEEFIESFETNMIPHVEE

SNPs (tot: 16)

Position	A %	C %	G %	T %	Probability
11		66		33	0.997452
13	33		66		0.997452
17	33		66		0.997452
18	66			33	0.997452
20	66		33		0.997452
21			33	66	0.997452
22			33	66	0.997452
46	66		33		0.997452
68	25		75		0.996473
70	75		25		0.996473
74			25	75	0.996473
75			25	75	0.996473
204		75	25		0.996473
317	25			75	0.996473
318		25		75	0.996473
321	75			25	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain