SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene7342

Length: 418 nt

Origin of reads: Uagpf v2

UniGene Fasta

>sp_v2.0_unigene7342
CGTCGTGACCTTGGCTGTCACTCATCTTTTTGCCATATCTGTATTGGGTCTGGTGGTTTTCATAGCTCGAGTCGTGGTGAGTTTCCCGGTCAGTCATTTTCTCTGGTTCGAGGGTGATGCCTGTGTTCAGTTATGGGATGGGGATGATTATAGAAGCGGATGGGCACTCTGGCTATGGGCTTTCTTCGGTGGCGGGTGCTTGGTGTTCTCCTTCTTCTGTGACTCGGTGGTTGTTTCAGCTCTTTCTCAGAACATAGGATCTCTGCACTTTGGAGTTAATGAAAAAGGATGTGGTGGCAATAATAGGTCCACAATACTCTGACCTTGCTCATGTTGTATCTCATATAGCAAATGGACTTCAAATACCACTTTTGTCCTTTGCAGCTACTGATCCTTCTTTGACATCATATGAATACCC

Ace file of the UniGene sp_v2.0_unigene7342

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glutamate receptor n=1 Tax=Sorghum bicolor RepID=C5X740_SORBI	-	-	7.0e-12	67%
FL-Next	sp=Glutamate receptor 3.1; Oryza sativa subsp. japonica (Rice).	-	-	0.0	63%
Blast2go	glutamate receptor -like	-	-	1.22615e-14	86%

Source	GOs	Term	Type	e value	Identity
Blast2go	DNA metabolic process	GO:0006259	Biological Process	1.22615e-14	86%
Blast2go	G-protein coupled receptor signaling pathway	GO:0007186	Biological Process	1.22615e-14	86%
Blast2go	ion transport	GO:0006811	Biological Process	1.22615e-14	86%
Blast2go	extracellular-glutamate-gated ion channel activity	GO:0005234	Molecular Function	1.22615e-14	86%
Blast2go	ionotropic glutamate receptor activity	GO:0004970	Molecular Function	1.22615e-14	86%
Blast2go	G-protein coupled receptor activity	GO:0004930	Molecular Function	1.22615e-14	86%
Blast2go	G-protein coupled GABA receptor activity	GO:0004965	Molecular Function	1.22615e-14	86%
Blast2go	DNA binding	GO:0003677	Molecular Function	1.22615e-14	86%
Blast2go	ATP binding	GO:0005524	Molecular Function	1.22615e-14	86%
Blast2go	DNA-dependent ATPase activity	GO:0008094	Molecular Function	1.22615e-14	86%
Blast2go	outer membrane-bounded periplasmic space	GO:0030288	Cellular Component	1.22615e-14	86%
Blast2go	integral to membrane	GO:0016021	Cellular Component	1.22615e-14	86%
Blast2go	cytoplasmic membrane-bounded vesicle	GO:0016023	Cellular Component	1.22615e-14	86%

Source	InterPros	Term	Type	Identity
Sma3	GPCR, family 3	IPR000337	-	-
Sma3	Ionotropic glutamate receptor	IPR001320	-	-
Sma3	Extracellular ligand-binding receptor	IPR001828	-	-
Sma3	GPCR, family 3, gamma-aminobutyric acid receptor, type B	IPR002455	-	-
Sma3		IPR015683	-	-
Sma3	Ionotropic glutamate receptor, plant	IPR017103	-	-

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: sp_plants

Fln subject: Q7XP59

Fln msg: Distance to subject end: 801 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 46 - 938

Fln protein: MKKDVVAIIGPQYSDLAHVVSHIANGLQIPLLSFAATDPSLTSYEY

Protein Length: 47

Fln nts: CGTCGTGACCTTGGCTGTCACTCATCTTTTTGCCATATCTGTATTGGGTCTGGTGGTTTTCATAGCTCGAGTCGTGGTGAGTTTCCCGGTCAGTCATTTTCTCTGGTTCGAGGGTGATGCCTGTGTTCAGTTATGGGATGGGGATGATTATAGAAGCGGATGGGCACTCTGGCTATGGGCTTTCTTCGGTGGCGGGTGCTTGGTGTTCTCCTTCTTCTGTGACTCGGTGGTTGTTTCAGCTCTTTCTCAGAACATAGGATCTCTGCACTTTGGAGTTA_-_ATGAAAAAGGATGTGGTGGCAATAATAGGTCCACAATACTCTGACCTTGCTCATGTTGTATCTCATATAGCAAATGGACTTCAAATACCACTTTTGTCCTTTGCAGCTACTGATCCTTCTTTGACATCATATGAATACCC

Fln Alignment:

Contig7342___LELMKKDVVAIIGPQYSDLAHVVSHIANGLQIPLLSFAATDPSLTSYEY
Q7XP59______________LQFMEKDTVAIIGPLSSTTAHVLSHLANELHVPLMSFSATDPTLSSLEY

SNPs (tot: 7)

Position	C %	G %	T %	Probability
77	40	60		1.0
82	40	60		1.0
83	40		60	1.0
86	60	40		1.0
87	60	40		1.0
89		60	40	1.0
94	28	71		1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain

Position	C %	G %	T %	Probability
77	40	60		1.0
82	40	60		1.0
83	40		60	1.0
86	60	40		1.0
87	60	40		1.0
89		60	40	1.0
94	28	71		1.0

Position	C %	G %	T %	Probability
77	40	60		1.0
82	40	60		1.0
83	40		60	1.0
86	60	40		1.0
87	60	40		1.0
89		60	40	1.0
94	28	71		1.0

Position	C %	G %	T %	Probability
77	40	60		1.0
82	40	60		1.0
83	40		60	1.0
86	60	40		1.0
87	60	40		1.0
89		60	40	1.0
94	28	71		1.0