SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene4792

Length: 433 nt

Origin of reads: Biogeco3 v1

UniGene Fasta

>sp_v2.0_unigene4792
CAAAGTGCAGGAACTCAACTTTAAAAGCAAGCCAAATGTATGGGCATATTTCTCTGTTAAGTCAGGAGGAGGAATTCACGAGTTTTCAGATTCTCAGTTTGGTCACGTGTTTGCTTTCGGAGAATCTCGAGCTTTGGCCATAGCTAATATGGTACTTGGACTGAAGGAACTTCATATTCGAGGAGAGATTCGTACTAATGTTGACTACACAGTAGACCTTCTGCATGATGTGGAATATAGAGAAAACAAGATTCACACTGGTTGGCTAGACAGTAGGATTGCAATGCATGTTAGAGCAGAGAGGCCACATTGGTACCTTTCAGTGGTTGGAGGAGCACTCTATAAAGCGACAACAATGAGTGCGGCAAGGGTTTCTGAATATATTGGGTATCTTGAGAAAGGACAAATCCCGCCAAAGAATATCTCTTACATT

Ace file of the UniGene sp_v2.0_unigene4792

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	acetyl-CoA carboxylase [Brassica napus]	-	-	87%
FL-Next	sp=Acetyl-CoA carboxylase 1; Arabidopsis thaliana (Mouse-ear cress).	-	-	86%
Blast2go	acetyl- carboxylase	-	-	93%

Source	ECs	Term	Type	e value	Identity
Blast2go	Acetyl-CoA carboxylase.	EC:6.4.1.2	-	0.0	93%

Source	KEGGs	Term	Type	Identity
Blast2go	Fatty acid biosynthesis	00061		93%
Blast2go	Tetracycline biosynthesis	00253		93%
Blast2go	Pyruvate metabolism	00620		93%
Blast2go	Propanoate metabolism	00640		93%
Blast2go	Carbon fixation pathways in prokaryotes	00720		93%
Blast2go	Metabolic pathways	01100		93%
Blast2go	Biosynthesis of secondary metabolites	01110		93%
Blast2go	Biotin carboxylase.	EC:6.3.4.14	-	93%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Fatty acid biosynthesis	00061		0.0	93%
Blast2go	Metabolic pathways	01100		0.0	93%

Source	GOs	Term	Type	Identity
Blast2go	1-aminocyclopropane-1-carboxylate biosynthetic process	GO:0042218	Biological Process	93%
Blast2go	root development	GO:0048364	Biological Process	93%
Blast2go	response to cytokinin stimulus	GO:0009735	Biological Process	93%
Blast2go	primary shoot apical meristem specification	GO:0010072	Biological Process	93%
Blast2go	fatty acid elongation	GO:0030497	Biological Process	93%
Blast2go	acetyl-CoA carboxylase activity	GO:0003989	Molecular Function	93%
Blast2go	ATP binding	GO:0005524	Molecular Function	93%
Blast2go	biotin carboxylase activity	GO:0004075	Molecular Function	93%
Blast2go	plasma membrane	GO:0005886	Cellular Component	93%

Source	InterPros	Term	Type	Identity
Sma3	Carboxyl transferase	IPR000022	-	-
Sma3	Biotin/lipoyl attachment	IPR000089	-	-
Sma3	Biotin-binding site	IPR001882	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	Carbamoyl-phosphate synthase, large subunit, N-terminal	IPR005481	-	-
Sma3	Biotin carboxylase, C-terminal	IPR005482	-	-
Sma3	ATP-grasp fold	IPR011761	-	-
Sma3	Acetyl-coenzyme A carboxyltransferase, N-terminal	IPR011762	-	-
Sma3	Acetyl-coenzyme A carboxyltransferase, C-terminal	IPR011763	-	-
Sma3	Biotin carboxylation domain	IPR011764	-	-
Sma3	Acetyl-CoA carboxylase, central domain	IPR013537	-	-
Sma3	ATP-grasp fold, subdomain 1	IPR013815	-	-
Sma3	ATP-grasp fold, subdomain 2	IPR013816	-	-
Sma3		IPR013817	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q38970

Fln msg: Distance to subject end: 1661 aas, your sequence is shorter than subject: 144 - 2254

Fln protein: KVQELNFKSKPNVWAYFSVKSGGGIHEFSDSQFGHVFAFGESRALAIANMVLGLKELHIRGEIRTNVDYTVDLLHDVEYRENKIHTGWLDSRIAMHVRAERPHWYLSVVGGALYKATTMSAARVSEYIGYLEKGQIPPKNISYI

Protein Length: 145

Fln nts: CAAAGTGCAGGAACTCAACTTTAAAAGCAAGCCAAATGTATGGGCATATTTCTCTGTTAAGTCAGGAGGAGGAATTCACGAGTTTTCAGATTCTCAGTTTGGTCACGTGTTTGCTTTCGGAGAATCTCGAGCTTTGGCCATAGCTAATATGGTACTTGGACTGAAGGAACTTCATATTCGAGGAGAGATTCGTACTAATGTTGACTACACAGTAGACCTTCTGCATGATGTGGAATATAGAGAAAACAAGATTCACACTGGTTGGCTAGACAGTAGGATTGCAATGCATGTTAGAGCAGAGAGGCCACATTGGTACCTTTCAGTGGTTGGAGGAGCACTCTATAAAGCGACAACAATGAGTGCGGCAAGGGTTTCTGAATATATTGGGTATCTTGAGAAAGGACAAATCCCGCCAAAGAATATCTCTTACATT

Fln Alignment:

Contig4792___KVQELNFKSKPNVWAYFSVKSGGGIHEFSDSQFGHVFAFGESRALAIANMVLGLKELHIRGEIRTNVDYTVDLLHDVEYRENKIHTGWLDSRIAMHVRAERPHWYLSVVGGALYKATTMSAARVSEYIGYLEKGQIPPKNISYI
Q38970______________RVQELSFKSKPNVWAYFSVKSGGGIHEFSDSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLHASDYRDNKIHTGWLDSRIAMRVRAERPPWYLSVVGGALYKASATSAAVVSDYVGYLEKGQIPPKHISLV

SNPs (tot: 6)

Position	A %	C %	G %	T %	Probability
136	16		83		0.994512
137	16		83		0.994512
138		83		16	0.994512
139		83	16		0.994512
140	83			16	0.994512
308	80	20			0.995493

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain