SustainPineDB

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene91536

Length: 1167 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

Ace file of the UniGene sp_v2.0_unigene91536 (antisense)

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	triacylglycerol lipase 1 [Arabidopsis thaliana] sp\|Q71DJ5.1\|LIP1_ARATH RecName: Full=Triacylglycerol lipase 1; Flags: Precursor gb\|AAN77143.1\| putative triacylglycerol/steryl ester hydrolase [Arabidopsis thaliana] gb\|ABF58965.1\| At2g15230 [Arabidopsis tha	-	-	41%
FL-Next	tr=Predicted protein; Physcomitrella patens subsp. patens (Moss).	-	-	50%
Blast2go	protein	-	-	62%

Source	ECs	Term	Type	e value	Identity
Blast2go	Galactolipase.	EC:3.1.1.26	-	0.0	62%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Glycerolipid metabolism	00561		0.0	62%
Blast2go	Triacylglycerol lipase.	EC:3.1.1.3	-	0.0	62%

Source	KEGGs	Term	Type	Identity
Blast2go	Glycerolipid metabolism	00561		62%
Blast2go	Metabolic pathways	01100		62%
Blast2go	Lipoyl synthase.	EC:2.8.1.8	-	62%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Lipoic acid metabolism	00785		0.0	62%
Blast2go	Metabolic pathways	01100		0.0	62%

Source	GOs	Term	Type	Identity
Blast2go	lipoate biosynthetic process	GO:0009107	Biological Process	62%
Blast2go	photomorphogenesis	GO:0009640	Biological Process	62%
Blast2go	circadian regulation of gene expression	GO:0032922	Biological Process	62%
Blast2go	glycine catabolic process	GO:0006546	Biological Process	62%
Blast2go	galactolipase activity	GO:0047714	Molecular Function	62%
Blast2go	phospholipase activity	GO:0004620	Molecular Function	62%
Blast2go	GTPase activity	GO:0003924	Molecular Function	62%
Blast2go	triglyceride lipase activity	GO:0004806	Molecular Function	62%
Blast2go	lipoate synthase activity	GO:0016992	Molecular Function	62%
Blast2go	extracellular space	GO:0005615	Cellular Component	62%
Blast2go	mitochondrial matrix	GO:0005759	Cellular Component	62%
Blast2go	nucleus	GO:0005634	Cellular Component	62%

Full-Lengther Next Prediction

Fln status: Complete

Fln database: tr_plants

Fln subject: A9SSB0

Fln msg: Separated hits, possible frame ERROR between 281 and 724,

Fln protein: MDTNTGAPDGLCSTFVEPYYSKYDCHEYSTVTPDGFRLGLQRINSRSDSGQKGPLLLNHGVLNGGDAWVLNSPDEFDVSPAFVLADAGLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKFPFYDQYETQSTSTKNLVHLAQLYREDKFQKYDYGAAENNQRYNSIYPPAYDLSKVPTKNLLLVYGGFLADLVDVQRLKNELSPGYKYLFKPNFAHLDFIVANNCKQQLYDEVMAFFEDEQNMGITF*

Protein Length: 369

Fln nts: GTATTGAG_-_ATGGATACTAATACGGGCGCTCCAGATGGTTTATGCTCCACATTCGTGGAGCCTTATTATTCTAAATATGATTGCCATGAGTATAGTACTGTGACCCCAGATGGATTTCGGTTGGGACTGCAGAGGATCAATTCTCGCTCCGATTCGGGGCAAAAGGGTCCTCTTCTGTTGAACCATGGAGTTCTGAACGGTGGAGATGCTTGGGTGTTGAATTCGCCTGATGAATTCGATGTATCGCCGGCATTCGTTCTGGCAGATGCGGGACTACGCGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCAAATTTCCCTTCTACGACCAATACGAGACGCAGTCGACCTCAACGAAGAATTTGGTTCATTTAGCTCAATTATATAGAGAAGACAAGTTTCAGAAATATGATTATGGGGCCGCAGAGAACAATCAGAGGTATAATTCCATCTATCCTCCGGCATATGATCTGTCCAAAGTGCCTACCAAAAACTTGCTGCTCGTCTATGGAGGCTTTTTGGCAGATCTAGTGGATGTGCAGAGGTTGAAGAATGAGTTGAGTCCAGGATACAAATATCTGTTCAAGCCAAATTTTGCTCATTTGGATTTCATTGTCGCTAACAACTGCAAGCAACAGCTCTACGACGAAGTCATGGCCTTCTTTGAGGATGAGCAAAACATGGGCATCACCTTCTGA___AGACAGGGATGCAGTAGATTTCATTTTTTCTTCATGACACAATATACAGATGTAACG

Fln Alignment:

uma_euler_10322___YDCHEYSTVTPDGFRLGLQRIN---SRSDSGQKGPLLLNHGVLNGGDAWVLNSPDEFDVSPAFVLADAGLRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKFPFYDQYETQSTSTKNLVHLAQLYREDKFQKYDYGAAENNQRYNSIYPPAYDLSKVP-TKNLLLVYG--GFLADLVDVQRLKNELSPGYKYLFKPNFAHLDFIVANNCKQQLYDEVMAFF
A9SSB0_______________YACREYTVETEDGFLLGLQRISPAIERSNVTKRLPVVLQHGLLQGGDNWVLNFPGQ---SLGFILADEGFDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRIPYYLQFEPHSTSLKNLAHLAQMIRRGTFCKYDYGYLGNLQHYQSLFPPAYDLTAIPRSLPLWMAYGDNDALADPVDVLRTVKQLRRKPEIVVLPDYGHLDFIFSINAKGDLYDSMIAFF

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain