UniGene Name: sp_v2.0_unigene84581
Length: 204 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v2.0_unigene84581
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative retroelement pol polyprotein [Arabidopsis thaliana] | - | - | 2.0e-17 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Blast2go | retrotransposon expressed | - | - | 1.26845e-21 | 80% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 266 aas, your sequence is shorter than subject: 67 - 363
Fln protein:
G
Protein Length:
68
Fln nts:
A
Fln Alignment:
biogeco1_euler_6929___YKIKHRSDGSAEKFKARFVARGFSQKEGIDYDDIFAPVARYTTIRSIIALAATQGWSLHQMDVKTA
B8LKV8_______________YKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain